BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0737.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 25 0.69 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 4.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 4.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 4.9 AB248729-1|BAF02606.1| 43|Apis mellifera distal-less protein. 21 8.5 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 536 FRVLVLYEEQERLVNHHFIVXFVVLTEFVHYSYF 637 F LV++ ER + HH I F T V S+F Sbjct: 186 FSRLVVFFRFERQIGHHLIQTFAPSTLVVMLSWF 219 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 688 VWYRGQRNWPVSAHS-ATEIGIVNK 617 +W RG ++ P+SA S E G++ K Sbjct: 436 IWARGTKDIPISACSLPCEPGMIKK 460 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 353 LLRTQNLQVPAPPVV 309 LL + L VPAPPV+ Sbjct: 347 LLNEKTLAVPAPPVL 361 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 353 LLRTQNLQVPAPPVV 309 LL + L VPAPPV+ Sbjct: 347 LLNEKTLAVPAPPVL 361 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 353 LLRTQNLQVPAPPVV 309 LL + L VPAPPV+ Sbjct: 347 LLNEKTLAVPAPPVL 361 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 146 FPMILQLSSSEMNDYRHK 199 FP ++ +S +NDY+HK Sbjct: 657 FPANIEGTSYFLNDYKHK 674 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 688 VWYRGQRNWPVSAHS-ATEIGIVNK 617 +W RG ++ P+SA S E G++ K Sbjct: 526 IWARGTKDIPISACSLPCEPGMIKK 550 >AB248729-1|BAF02606.1| 43|Apis mellifera distal-less protein. Length = 43 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -2 Query: 403 RISLRAAKTLEQTEINNCFEHKIYKYQRRL 314 R L A+ L QT++ F+++ KY++ + Sbjct: 11 RAELAASLGLTQTQVKIWFQNRRSKYKKMM 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,932 Number of Sequences: 438 Number of extensions: 4023 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -