BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0733.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 5e-23 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 6e-22 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 92 5e-19 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 7e-18 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 81 6e-16 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 75 4e-14 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 73 2e-13 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 73 2e-13 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 73 2e-13 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 73 2e-13 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 73 2e-13 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 73 2e-13 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 73 2e-13 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 73 2e-13 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 73 2e-13 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 73 2e-13 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 73 2e-13 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 73 2e-13 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 73 2e-13 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 73 2e-13 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 73 3e-13 SB_46507| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 71 9e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 71 9e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 71 9e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 71 9e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 71 9e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 71 9e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 71 9e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 71 9e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 71 9e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 71 9e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 71 9e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 71 9e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 71 9e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 71 9e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 71 9e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 71 9e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 71 9e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 71 9e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 71 9e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 71 9e-13 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 71 9e-13 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 71 9e-13 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 71 9e-13 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 71 9e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 71 9e-13 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 71 9e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 71 9e-13 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 71 9e-13 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 71 9e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 71 9e-13 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 71 9e-13 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 71 9e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 71 9e-13 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 71 9e-13 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 71 9e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 71 9e-13 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 71 9e-13 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 71 9e-13 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 71 9e-13 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 71 9e-13 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 71 9e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 71 9e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 71 9e-13 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 71 9e-13 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 71 9e-13 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 71 9e-13 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 71 9e-13 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 71 9e-13 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 71 9e-13 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 71 9e-13 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 71 9e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 71 9e-13 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 71 9e-13 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 71 9e-13 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 71 9e-13 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 71 9e-13 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 71 9e-13 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 71 9e-13 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 71 9e-13 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 71 9e-13 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 71 9e-13 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 71 9e-13 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 71 9e-13 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 71 9e-13 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 71 9e-13 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 71 9e-13 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 71 9e-13 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 105 bits (251), Expect = 5e-23 Identities = 56/75 (74%), Positives = 62/75 (82%), Gaps = 5/75 (6%) Frame = +1 Query: 484 IVSRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KW 657 +VSRITIH SFYNVVTGKTLALPNLIALQHIPLS AGVIAEEARTDRPSQQLR+L +W Sbjct: 36 VVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 Query: 658 P---NGKL*AVNILV 693 +G L A ++V Sbjct: 96 DAPCSGALSAAGVVV 110 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 101 bits (242), Expect = 6e-22 Identities = 54/73 (73%), Positives = 60/73 (82%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNLIALQHIPLS AGV +EEARTDRPSQQLR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 100 bits (240), Expect = 1e-21 Identities = 50/75 (66%), Positives = 58/75 (77%), Gaps = 1/75 (1%) Frame = -3 Query: 693 YQNIYRLQFAIWPFQGAQLLGRXIGAGLFGYYASXRKGDVLQGD*-VG*RQGFPSHDVVK 517 +Q+++ L+ + P Q AQLLGR IGAGLF + KGDVLQGD +G RQGFPSHDVVK Sbjct: 29 HQDLFILRSDL-PSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVK 87 Query: 516 RRAVNCNTTHYRANW 472 RR VNCNTTHYRANW Sbjct: 88 RRPVNCNTTHYRANW 102 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 99 bits (238), Expect = 2e-21 Identities = 53/74 (71%), Positives = 60/74 (81%), Gaps = 5/74 (6%) Frame = +1 Query: 487 VSRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP 660 +SRITIH PSFYNVVTGKTLALPNLIALQHIPLS AG+ EEARTDRPSQQLR+L +W Sbjct: 79 MSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEWD 138 Query: 661 ---NGKL*AVNILV 693 +G L A ++V Sbjct: 139 APCSGALSAAGVVV 152 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 91.9 bits (218), Expect = 5e-19 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = +3 Query: 519 LQRRDWENPGVTQLNRLAAHPPFXSWRNSRRGPHRSXFPTVAHPEMAKWQIVSGKYF 689 LQRRDWENPGVTQLNRLAAHPPF SWRNS R PHRS FPTVA PE W++ +YF Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPE---WRMGLMRYF 400 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 89.4 bits (212), Expect = 2e-18 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 505 HCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL 651 H PSFYNVVTGKTLALPNLIALQHIPLS AG +EEARTDRPSQQLR+L Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSL 53 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 89.0 bits (211), Expect = 3e-18 Identities = 49/73 (67%), Positives = 56/73 (76%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNLIALQHIP + +EEARTDRPSQQLR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 87.8 bits (208), Expect = 7e-18 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNL L+HIPL + +EEARTDRPSQQLR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 85.8 bits (203), Expect = 3e-17 Identities = 39/67 (58%), Positives = 53/67 (79%) Frame = +1 Query: 1 YVAAYLLAVLGGKTTPAAADVEKILSSVGIEADGEKLKKVITELNGKDVEQLIAAGREKL 180 YVAAYLLA LG P+A D++ IL SVGIE+D E+L KVI+EL+GK V+++I AG+ KL Sbjct: 652 YVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKSKL 711 Query: 181 SSMPVGG 201 +++P GG Sbjct: 712 ATVPTGG 718 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 81.4 bits (192), Expect = 6e-16 Identities = 46/73 (63%), Positives = 53/73 (72%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNLIALQHIPLS AGVIA+ +QLR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 80.2 bits (189), Expect = 1e-15 Identities = 46/73 (63%), Positives = 54/73 (73%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNLIALQ P + +EEARTDRPSQ+LR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 79.8 bits (188), Expect = 2e-15 Identities = 46/73 (63%), Positives = 53/73 (72%), Gaps = 5/73 (6%) Frame = +1 Query: 490 SRITIHCPSFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KWP- 660 SRITIH PSFYNVVTGKTLALPNLIAL P + +EEARTDRPSQQLR+L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEWDA 61 Query: 661 --NGKL*AVNILV 693 +G L A ++V Sbjct: 62 PCSGALSAAGVVV 74 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 79.4 bits (187), Expect = 3e-15 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = -2 Query: 625 DRCGPLRLLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 DRCGPLR KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 69 DRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 79.4 bits (187), Expect = 3e-15 Identities = 41/69 (59%), Positives = 46/69 (66%) Frame = -3 Query: 678 RLQFAIWPFQGAQLLGRXIGAGLFGYYASXRKGDVLQGD*VG*RQGFPSHDVVKRRAVNC 499 R+ FAI Q AQLLGR IGAGLF + +G + +G FPSHDVVKRR VNC Sbjct: 2 RVPFAI---QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNC 58 Query: 498 NTTHYRANW 472 NTTHYRANW Sbjct: 59 NTTHYRANW 67 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 78.6 bits (185), Expect = 5e-15 Identities = 36/49 (73%), Positives = 36/49 (73%) Frame = -2 Query: 646 CATVGKXDRCGPLRLLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 CATVGK DRCGPLR KG RLSWVTPGFSQSRRCKTT SEL Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/50 (72%), Positives = 36/50 (72%) Frame = -2 Query: 649 GCATVGKXDRCGPLRLLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 GCATVGK DRCGPLR KG A RLS TPGFSQSRRCKTT SEL Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 75.4 bits (177), Expect = 4e-14 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -3 Query: 651 QGAQLLGRXIGAGLFGYYASXRKGDVLQGD*VG*RQGFPSHDVVKRRAVNCNTTHYRANW 472 Q AQLLGR IGAGLF + +G + + FPSHDVVKRR VNCNTTHYRANW Sbjct: 2 QAAQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 658 AISGCATVGKXDRCGPLRLLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 A+SG + LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 79 AVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -1 Query: 695 FTKIFTAYNLPFGHFRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 F + +A +P +RNCWEGRSVRASS + + G + + Sbjct: 67 FEAVNSARLMPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRL 111 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 235 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 219 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 249 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 903 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -1 Query: 662 FGHFR-VRNCWEGRSVRASSAITPAXERGMCCKAI 561 FG F+ +RNCWEGRSVRASS + + G + + Sbjct: 883 FGKFKQLRNCWEGRSVRASSLLRQLAKGGCAARRL 917 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 15 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 390 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 374 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 404 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 239 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 ++RNCWEGRSVRASS + + G + + Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKGGCAARRL 253 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 306 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 290 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 320 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 372 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 358 LRNCWEGRSVRASSLLRQLAKGGCAARRL 386 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 64 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNC EGRSVRASS + + G + + Sbjct: 48 FRLRNCGEGRSVRASSLLRQLAKGGCAARRL 78 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 46 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 30 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 60 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 282 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 R+RNCWEGRSVRASS + + G + + Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 296 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 266 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 665 PFGHFRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 P ++RNCWEGRSVRASS + + G + + Sbjct: 246 PVNREKLRNCWEGRSVRASSLLRQLAKGGCAARRL 280 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 255 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -1 Query: 659 GHF--RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 GH R+RNCWEGRSVRASS + + G + + Sbjct: 235 GHLTIRLRNCWEGRSVRASSLLRQLAKGGCAARRL 269 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 280 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 264 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 294 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 464 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 448 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 478 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 133 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 647 VRNCWEGRSVRASSAITPAXERGMCCKAI 561 +RNCWEGRSVRASS + + G + + Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRL 147 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 299 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 283 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 313 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 149 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 133 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 163 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 342 LLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 208 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 ++RNCWEGRSVRASS + + G + + Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKGGCAARRL 222 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 600 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 584 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 614 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 236 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 ++RNCWEGRSVRASS + + G + + Sbjct: 221 KLRNCWEGRSVRASSLLRQLAKGGCAARRL 250 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 514 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 498 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 528 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 405 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 R+RNCWEGRSVRASS + + G + + Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 419 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 428 IKLIDTVDLXGGP 466 IKLIDTVDL GGP Sbjct: 323 IKLIDTVDLEGGP 335 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SEL Sbjct: 198 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 182 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 212 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = -2 Query: 637 VGKXDRCGPLRLLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL 500 +GK DRCGPLR KG RRLSWVTPGFSQSRRCKTT SEL Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -3 Query: 645 AQLLGRXIGAGLFGYYASXRKGDVLQ 568 AQLLG+ G YYAS RKGDVLQ Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQ 27 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.5 bits (170), Expect = 3e-13 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSEL*YDSL 485 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SE D L Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 87 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 117 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -1 Query: 653 FRVRNCWEGRSVRASSAITPAXERGMCCKAI 561 FR+RNCWEGRSVRASS + + G + + Sbjct: 7 FRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 117 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 151 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 72.5 bits (170), Expect = 3e-13 Identities = 40/69 (57%), Positives = 45/69 (65%) Frame = -3 Query: 678 RLQFAIWPFQGAQLLGRXIGAGLFGYYASXRKGDVLQGD*VG*RQGFPSHDVVKRRAVNC 499 R+ FAI Q AQLLGR IGAGLF + +G + + FPSHDVVKRR VNC Sbjct: 1835 RVPFAI---QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNC 1890 Query: 498 NTTHYRANW 472 NTTHYRANW Sbjct: 1891 NTTHYRANW 1899 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 72.5 bits (170), Expect = 3e-13 Identities = 34/59 (57%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNSRRGPHRSXFPTVAHPEM-AKWQIVSGKY 686 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS R+ P+ + +W+++ +Y Sbjct: 531 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWRLMRARY 587 >SB_46507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.1 bits (169), Expect = 4e-13 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +1 Query: 514 SFYNVVTGKTLALPNLIALQHIPLSXAGVIAEEARTDRPSQQLRTL--KW 657 S YN+VT KTL P LIAL HIPLS AGVIAEEARTDRPSQQ+ L KW Sbjct: 8 SSYNIVTVKTLLFPLLIALHHIPLSPAGVIAEEARTDRPSQQMHILNGKW 57 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 71.7 bits (168), Expect = 5e-13 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNSRR 611 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS + Sbjct: 125 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 157 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +E+ARTDRPSQQLR+L +W +G L A ++V Sbjct: 155 SEKARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 189 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 71.7 bits (168), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 604 LLRQLXKGGCAARRLSWVTPGFSQSRRCKTTGSE 503 LLRQL KGGCAARRLSWVTPGFSQSRRCKTT SE Sbjct: 545 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 650 RVRNCWEGRSVRASSAITPAXERGMCCKAI 561 R+RNCWEGRSVRASS + + G + + Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 559 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 71.7 bits (168), Expect = 5e-13 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNSRR 611 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS + Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 92 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +E+ARTDRPSQQLR+L +W +G L A ++V Sbjct: 90 SEKARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 124 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 7e-13 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNSRR 611 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS + Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQ 70 Score = 31.9 bits (69), Expect = 0.51 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +E+ARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEQARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 67 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 67 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 101 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 64 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 94 SEEARTDRPSQQLRSL 109 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 46 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 76 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 76 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 110 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 64 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 94 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 128 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 99 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 99 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 133 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 70 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 104 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 90 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 124 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 72 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 102 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 102 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 136 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 48 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 78 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 78 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 112 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 67 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 67 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 101 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 27 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 57 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 57 SEEARTDRPSQQLRSL 72 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 82 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 82 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 116 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 91 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 91 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 125 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 55 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 85 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 85 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 119 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 71 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 101 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 135 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 89 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 123 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 72 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 106 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 218 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 248 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLD 428 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 248 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 282 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 113 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 143 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLD 428 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 143 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 177 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 81 SEEARTDRPSQQLRSL 96 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 30 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 60 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 60 SEEARTDRPSQQLRSL 75 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 48 SEEARTDRPSQQLRSL 63 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 49 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 79 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 79 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 113 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 383 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 413 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 413 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 447 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 61 SEEARTDRPSQQLRSL 76 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 109 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 139 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 139 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 173 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 85 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 115 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 115 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 149 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 71 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 105 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 10 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 40 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 40 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 74 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 20 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 50 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 50 SEEARTDRPSQQLRSL 65 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 70 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 104 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 105 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 135 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 135 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 169 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 77 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 77 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 111 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 342 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 372 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 372 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 406 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 82 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 112 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 112 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 146 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 82 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 82 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 116 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 48 SEEARTDRPSQQLRSL 63 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 91 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 91 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 125 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 75 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 109 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 136 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 166 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 166 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 200 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 65 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 95 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 95 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 129 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 71 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 105 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 145 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 175 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 175 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 209 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 835 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 865 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 865 SEEARTDRPSQQLRSL 880 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 48 SEEARTDRPSQQLRSL 63 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 62 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 92 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 92 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 126 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 66 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 100 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 75 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 105 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 139 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 58 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 88 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 88 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 122 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 71 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 101 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 135 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 258 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 288 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 288 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 322 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 116 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 146 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 146 SEEARTDRPSQQLRSL 161 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 82 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 82 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 116 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 69 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 103 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 103 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 133 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 133 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 167 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 116 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 146 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLD 428 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 146 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 180 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 71 SEEARTDRPSQQLRSL 86 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 22 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 52 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 52 SEEARTDRPSQQLRSL 67 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 90 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 124 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 69 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 103 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 66 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 100 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 13 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 43 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 43 SEEARTDRPSQQLRSL 58 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 21 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 51 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 51 SEEARTDRPSQQLRSL 66 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 398 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 428 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 428 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 462 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 77 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 77 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 111 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 56 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 86 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 86 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 120 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 121 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 151 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 151 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 185 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 57 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 87 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 121 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 67 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 97 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLDIEF 419 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 97 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 131 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 70 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 100 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 100 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 134 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 416 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 446 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 446 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 480 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 113 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 143 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 143 SEEARTDRPSQQLRSL 158 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 99 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 99 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 133 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 58 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 88 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 88 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 122 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 48 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 78 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 78 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 112 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 163 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 193 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 193 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 227 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 67 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 97 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLDIEF 419 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 97 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 131 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 54 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 84 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 84 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 118 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 90 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 120 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 120 SEEARTDRPSQQLRSL 135 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 69 SEEARTDRPSQQLRSL 84 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 65 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 95 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 95 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 129 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 44 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 74 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 74 SEEARTDRPSQQLRSL 89 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 187 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 217 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 217 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 251 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 66 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 100 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 72 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 106 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 56 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 86 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 86 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 120 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 53 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 83 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 83 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 117 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 66 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 66 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 100 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 67 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 67 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 101 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 81 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 115 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 71 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 71 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 105 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 134 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 164 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 164 SEEARTDRPSQQLRSL 179 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 43 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 73 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 73 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 107 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 86 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 116 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 116 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 150 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 24 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 54 SEEARTDRPSQQLRSL 69 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 155 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 185 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 185 SEEARTDRPSQQLRSL 200 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 342 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 372 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 372 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 406 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 89 SEEARTDRPSQQLRSL 104 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 23 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 53 SEEARTDRPSQQLRSL 68 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 49 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 79 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 79 SEEARTDRPSQQLRSL 94 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 111 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 141 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 141 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 175 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 88 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 118 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 118 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 152 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 62 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 92 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 92 SEEARTDRPSQQLRSL 107 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 296 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 326 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 326 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 360 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 89 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 123 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 90 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 90 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 124 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 48 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 48 SEEARTDRPSQQLRSL 63 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 413 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 443 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 443 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 477 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 97 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 127 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLDIEF 419 GTGPPLEVDGIDKLDIEF Sbjct: 48 GTGPPLEVDGIDKLDIEF 65 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 127 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 161 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 53 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 83 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 83 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 117 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 75 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 109 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 95 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 125 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 125 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 159 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 75 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 109 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 213 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 243 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 243 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 277 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 75 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 109 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 215 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 245 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 245 SEEARTDRPSQQLRSL 260 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 35 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 65 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 65 SEEARTDRPSQQLRSL 80 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 50 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 80 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 80 SEEARTDRPSQQLRSL 95 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 70 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 104 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 75 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 109 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 149 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 179 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLD 428 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 179 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 213 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 77 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 77 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 111 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 67 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 67 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 101 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 57 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 87 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 87 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 121 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 72 SEEARTDRPSQQLRSL 87 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 77 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 107 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 107 SEEARTDRPSQQLRSL 122 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 197 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 227 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 227 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 261 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 55 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 85 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 85 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 119 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 34 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 64 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 64 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 98 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 88 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 118 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 118 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 152 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 24 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 54 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 54 SEEARTDRPSQQLRSL 69 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 81 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 115 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 189 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 219 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 219 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 253 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 89 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 123 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 99 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 99 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 133 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 82 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 82 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 116 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 89 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 89 SEEARTDRPSQQLRSL 104 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 102 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 132 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 132 SEEARTDRPSQQLRSL 147 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 78 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 108 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 108 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 142 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 98 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 472 GTGPPLEVDGIDKLD 428 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 128 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 162 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 75 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 105 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 105 SEEARTDRPSQQLRSL 120 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 72 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 72 SEEARTDRPSQQLRSL 87 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 81 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 81 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 115 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 665 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 695 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 695 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 729 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 50 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 80 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 80 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 114 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 69 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 69 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 103 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 30 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 60 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 60 SEEARTDRPSQQLRSL 75 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 148 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 178 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 178 SEEARTDRPSQQLRSL 193 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 70 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 70 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 104 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 61 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 61 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 95 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 91 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 91 SEEARTDRPSQQLRSL 106 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 90 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 120 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 120 SEEARTDRPSQQLRSL 135 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 68 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL--KWP---NGKL*AVNILV 693 +EEARTDRPSQQLR+L +W +G L A ++V Sbjct: 68 SEEARTDRPSQQLRSLNGEWDAPCSGALSAAGVVV 102 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 70.9 bits (166), Expect = 9e-13 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 513 VVLQRRDWENPGVTQLNRLAAHPPFXSWRNS 605 VVLQRRDWENPGVTQLNRLAAHPPF SWRNS Sbjct: 102 VVLQRRDWENPGVTQLNRLAAHPPFASWRNS 132 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 604 AEEARTDRPSQQLRTL 651 +EEARTDRPSQQLR+L Sbjct: 132 SEEARTDRPSQQLRSL 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,186,227 Number of Sequences: 59808 Number of extensions: 311493 Number of successful extensions: 9297 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9245 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -