BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0732.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 1.7 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 7.0 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 250 NDKPKSWRVQAVPIDPMSFVLRKALHS-AWRGIRDDNLSSVSGI 122 +DK K+W Q P+D V+ A + WR + D ++ V I Sbjct: 284 DDKVKAWHSQGTPLD--KIVVGIATYGRGWRLVGDSGITGVPPI 325 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 402 RNLVRKAIDNRFQIHKSGEIVVFNER 325 R+ + +AID F + KSG ++ +E+ Sbjct: 313 RDRIHEAIDQGFVLDKSGNRIMLDEQ 338 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 739,438 Number of Sequences: 2352 Number of extensions: 15823 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -