BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0731.Seq (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 1.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 216 FPLNQESPGVERRAPQLFLYN 278 FP+ PG+ R AP+L Y+ Sbjct: 77 FPIKNTEPGMFRVAPELLGYS 97 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.6 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = -3 Query: 58 VLRTMHLLYFCVIKII 11 ++ T+HLL++CV+ I+ Sbjct: 220 IIFTIHLLFYCVLIIL 235 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 247 RGAPLNSSCTTGGRVARRRRLSHLVEFKKCLEI 345 R A LN++ T G RRL+ E K LE+ Sbjct: 1441 RFAKLNANGTNAGTPVLSRRLTMRRETMKALEV 1473 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 247 RGAPLNSSCTTGGRVARRRRLSHLVEFKKCLEI 345 R A LN++ T G RRL+ E K LE+ Sbjct: 1441 RFAKLNANGTNAGTPVLSRRLTMRRETMKALEV 1473 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 247 RGAPLNSSCTTGGRVARRRRLSHLVEFKKCLEI 345 R A LN++ T G RRL+ E K LE+ Sbjct: 1441 RFAKLNANGTNAGTPVLSRRLTMRRETMKALEV 1473 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 247 RGAPLNSSCTTGGRVARRRRLSHLVEFKKCLEI 345 R A LN++ T G RRL+ E K LE+ Sbjct: 1441 RFAKLNANGTNAGTPVLSRRLTMRRETMKALEV 1473 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,636 Number of Sequences: 336 Number of extensions: 3104 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -