BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0731.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 27 0.39 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 8.3 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 27.5 bits (58), Expect = 0.39 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 419 PLNTRWAVNSFTHLSN--KKKPPLPLFISRHFLN 324 P R +N F H+ +KP LP+ + +H++N Sbjct: 138 PRRIRDVINVFHHIKQVRSQKPLLPMILDQHYIN 171 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 399 CELVHSPKQ*KKTSIAP 349 C+ ++ P Q KTS+AP Sbjct: 335 CDTINHPSQLAKTSLAP 351 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,644 Number of Sequences: 2352 Number of extensions: 12388 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -