BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0731.Seq (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53332-11|AAK31531.1| 668|Caenorhabditis elegans Protein tyrosi... 28 6.6 AF015882-1|AAC21678.1| 668|Caenorhabditis elegans protein tyros... 28 6.6 >U53332-11|AAK31531.1| 668|Caenorhabditis elegans Protein tyrosine phosphatase protein2 protein. Length = 668 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 177 GTRLDLSLNIFVGFPLNQESPGVERRAPQLFLYNWWTGRPPATA 308 G L+L ++V P + E+ E+R QL Y WW G PA++ Sbjct: 104 GLFLELKKPVYV--PYHLEACAEEQRRTQL--YRWWHGNLPASS 143 >AF015882-1|AAC21678.1| 668|Caenorhabditis elegans protein tyrosine phosphatase protein. Length = 668 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 177 GTRLDLSLNIFVGFPLNQESPGVERRAPQLFLYNWWTGRPPATA 308 G L+L ++V P + E+ E+R QL Y WW G PA++ Sbjct: 104 GLFLELKKPVYV--PYHLEACAEEQRRTQL--YRWWHGNLPASS 143 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,376,142 Number of Sequences: 27780 Number of extensions: 296083 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -