BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0729.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe... 26 6.0 SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering compo... 25 7.9 >SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 285 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 494 YLQPFYTNWCKFTMSFFTNIDEAD*LKIIGIRK 396 +L F TNWC +MS+ +A L+++G+ K Sbjct: 235 FLAFFPTNWCFSSMSYMVQSKKAA-LRLLGMTK 266 >SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering component Pep7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 25.4 bits (53), Expect = 7.9 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -3 Query: 423 LIKNHWNPKVP 391 ++KNHW P+VP Sbjct: 126 VVKNHWQPEVP 136 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,623,103 Number of Sequences: 5004 Number of extensions: 52354 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -