Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0729.Seq
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe...    26   6.0  
SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering compo...    25   7.9  

>SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 285

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -1

Query: 494 YLQPFYTNWCKFTMSFFTNIDEAD*LKIIGIRK 396
           +L  F TNWC  +MS+     +A  L+++G+ K
Sbjct: 235 FLAFFPTNWCFSSMSYMVQSKKAA-LRLLGMTK 266


>SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering
           component Pep7 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 536

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 423 LIKNHWNPKVP 391
           ++KNHW P+VP
Sbjct: 126 VVKNHWQPEVP 136


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,623,103
Number of Sequences: 5004
Number of extensions: 52354
Number of successful extensions: 106
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)