BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0729.Seq
(698 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe... 26 6.0
SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering compo... 25 7.9
>SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces
pombe|chr 3|||Manual
Length = 285
Score = 25.8 bits (54), Expect = 6.0
Identities = 12/33 (36%), Positives = 20/33 (60%)
Frame = -1
Query: 494 YLQPFYTNWCKFTMSFFTNIDEAD*LKIIGIRK 396
+L F TNWC +MS+ +A L+++G+ K
Sbjct: 235 FLAFFPTNWCFSSMSYMVQSKKAA-LRLLGMTK 266
>SPAC17G6.08 |pep7|vac1|prevacuole/endosomal FYVE tethering
component Pep7 |Schizosaccharomyces pombe|chr 1|||Manual
Length = 536
Score = 25.4 bits (53), Expect = 7.9
Identities = 7/11 (63%), Positives = 10/11 (90%)
Frame = -3
Query: 423 LIKNHWNPKVP 391
++KNHW P+VP
Sbjct: 126 VVKNHWQPEVP 136
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,623,103
Number of Sequences: 5004
Number of extensions: 52354
Number of successful extensions: 106
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -