BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0729.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30) 30 2.1 SB_24349| Best HMM Match : Exo_endo_phos (HMM E-Value=0.001) 28 6.3 SB_9753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30) Length = 1142 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 594 GADLEAA*ACNKP*LIYTYDKPHRTMIR 677 G DLE N P + TY+KPHR +R Sbjct: 320 GDDLERETMMNAPRMFITYEKPHRYQLR 347 >SB_24349| Best HMM Match : Exo_endo_phos (HMM E-Value=0.001) Length = 534 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +1 Query: 481 NGCKYESPSLNVATAQI*KQPFVDDIILSNIRSLQ*RLGQTSKLREHVTNPN*YTHMINH 660 N C S + ++ I FV ++LSN+RSL ++ ++RE ++N N I Sbjct: 63 NNCVQVSTTNSIQKTPISLNAFVPALLLSNVRSLAPKI---DEVREAISNANLDLACITE 119 Query: 661 TXL 669 T L Sbjct: 120 TWL 122 >SB_9753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +1 Query: 481 NGCKYESPSLNVATAQI*KQPFVDDIILSNIRSLQ*RLGQTSKLREHVTNPN*YTHMINH 660 N C S + ++ I FV ++LSN+RSL ++ ++RE ++N N I Sbjct: 63 NNCVQVSTTNSIQKTPISLNAFVPALLLSNVRSLAPKI---DEVREAISNANLDLACITE 119 Query: 661 TXL 669 T L Sbjct: 120 TWL 122 >SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 513 CCNCTDLKTTFCR*YNFIEYQVT 581 CCN T TT C ++ +Y+VT Sbjct: 292 CCNTTQCNTTQCNKHSVTQYRVT 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,912,709 Number of Sequences: 59808 Number of extensions: 362496 Number of successful extensions: 580 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -