BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0729.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 25 1.7 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 9.2 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 25.4 bits (53), Expect = 1.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 561 NYIIDKRLFLNLCSCNIK 508 N++IDKRL + SC ++ Sbjct: 207 NHLIDKRLIIGFSSCKVR 224 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 440 NIDEAD*LKIIGIRKFHFLNFTIKQVLPLCRVLFSCKFIMYL 315 N E D I IR+ L +T+ +LP + F C + YL Sbjct: 216 NPTETDITFYIIIRR-KTLFYTVNLILPTVLISFLCVLVFYL 256 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,712 Number of Sequences: 2352 Number of extensions: 12532 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -