BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0729.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 8.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.5 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 227 YRNLSHFFVSVVLKGSIYKPRYTGYT 150 Y N F + +Y PRYT YT Sbjct: 213 YNNADDSFQRLTSSTFVYDPRYTKYT 238 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.0 bits (47), Expect = 2.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 222 ESFSFLCFRCAKGIYL*TAIYGV-YPPQNRDEQTSSCD-TTHFVNLALVLML 73 ES +L +G L + Y YPPQNR ++ + T LA++L L Sbjct: 3 ESAVYLLGSEEEGNQLNRSFYSASYPPQNRSQEEDLWNLATDRAGLAILLFL 54 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 386 LNFTIKQVLPLCRVLFSCKFIMYL 315 L +T+ +LP + F C + YL Sbjct: 234 LFYTVNLILPTVLISFLCVLVFYL 257 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 Query: 411 HWNPKVPFPQF 379 H P PFPQF Sbjct: 152 HIGPSTPFPQF 162 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 390 FPQFYNKTGAASLSCFVFLQIYH 322 F Q Y G+ + FV +Q+Y+ Sbjct: 201 FYQIYATLGSFYIPLFVMIQVYY 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,610 Number of Sequences: 438 Number of extensions: 3773 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -