BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0728.Seq (548 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC031210-1|AAH31210.1| 521|Homo sapiens male-specific lethal 3-... 29 8.1 AF117065-1|AAD38499.1| 521|Homo sapiens male-specific lethal-3 ... 29 8.1 >BC031210-1|AAH31210.1| 521|Homo sapiens male-specific lethal 3-like 1 (Drosophila) protein. Length = 521 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/68 (19%), Positives = 32/68 (47%) Frame = +3 Query: 189 TNVTETVRGRPDRRLVPKTSSSRQSQKVG*PLFLKKYFTESCYFQSRQKFHINVKCKNNL 368 +++ E + + L + ++ + P LKK + CY+ +R+K + + C+ N+ Sbjct: 147 SDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNI 206 Query: 369 RKTRRTFV 392 ++V Sbjct: 207 ITILESYV 214 >AF117065-1|AAD38499.1| 521|Homo sapiens male-specific lethal-3 homolog 1 protein. Length = 521 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/68 (19%), Positives = 32/68 (47%) Frame = +3 Query: 189 TNVTETVRGRPDRRLVPKTSSSRQSQKVG*PLFLKKYFTESCYFQSRQKFHINVKCKNNL 368 +++ E + + L + ++ + P LKK + CY+ +R+K + + C+ N+ Sbjct: 147 SDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNI 206 Query: 369 RKTRRTFV 392 ++V Sbjct: 207 ITILESYV 214 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,712,492 Number of Sequences: 237096 Number of extensions: 1275935 Number of successful extensions: 5018 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5017 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -