BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0728.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 3.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.2 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 257 PEPKGRITTLSKKILYRKLLLSV*AKISY 343 PEP GR+ + L ++L +SV K+S+ Sbjct: 120 PEPFGRVRDHNISALCKELGISVVQKVSH 148 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 3.6 Identities = 7/32 (21%), Positives = 16/32 (50%) Frame = +2 Query: 440 LSEVLCLERRAWGERGVSAXWXWVRRPSXKRK 535 + E + +++R W ER + W+ R + + Sbjct: 65 VQENIVIDKRPWWERYQPISYKWITRSGTREQ 96 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 253 RARAKRSDNHSF*KNTLQKVVTFSLGKNFILTLNVK 360 + ++++ S + Q +VT GK+ + T N+K Sbjct: 971 KVQSQQQSQQSQQQQQQQTIVTNQAGKSILQTANIK 1006 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,431 Number of Sequences: 438 Number of extensions: 2653 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -