BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0727.Seq (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39270.2 68417.m05561 leucine-rich repeat transmembrane prote... 31 0.73 At4g39270.1 68417.m05562 leucine-rich repeat transmembrane prote... 31 0.73 At3g53240.1 68416.m05868 leucine-rich repeat family protein cont... 31 0.73 At3g23460.1 68416.m02956 cyclopropane fatty acid synthase-relate... 28 5.1 At3g05360.1 68416.m00584 disease resistance family protein / LRR... 28 6.8 At1g80080.1 68414.m09374 leucine-rich repeat family protein cont... 28 6.8 At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator... 28 6.8 At5g42140.1 68418.m05130 zinc finger protein, putative / regulat... 27 9.0 >At4g39270.2 68417.m05561 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinase erecta, Arabidopsis thaliana Length = 694 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 601 SLLNLMILKLTSREITSNIPESLSRVT 521 SLL L +L L+S IT IPESL+R++ Sbjct: 124 SLLTLEVLDLSSCSITGTIPESLTRLS 150 >At4g39270.1 68417.m05562 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinase erecta, Arabidopsis thaliana Length = 864 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 601 SLLNLMILKLTSREITSNIPESLSRVT 521 SLL L +L L+S IT IPESL+R++ Sbjct: 124 SLLTLEVLDLSSCSITGTIPESLTRLS 150 >At3g53240.1 68416.m05868 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 891 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 643 DFQIRSRCQRYQR*SLLNLMILKLTSREITSNIPESL 533 +F ++ R Y R +L + L L+S E++ NIPE L Sbjct: 686 EFAVKQRYDLYMRGTLNQMFGLDLSSNELSGNIPEEL 722 >At3g23460.1 68416.m02956 cyclopropane fatty acid synthase-related similar to cyclopropane synthase [Sterculia foetida] GI:21069167 Length = 305 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -1 Query: 661 DRFVPGDFQIRSRCQRYQR*SLLNLMILKLTSREITSNIPESLSRVT 521 D ++ GDF ++ LLNL+++ + S+E+ SN+ E R T Sbjct: 82 DAYINGDFSFVNK-----ETGLLNLIMILIASKELNSNLAEKRGRWT 123 >At3g05360.1 68416.m00584 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to elicitor-inducible LRR receptor-like protein EILP [Nicotiana tabacum] gi|6635236|dbj|BAA88636; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 786 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 598 LLNLMILKLTSREITSNIPESLSRVT 521 L L +L L+ TSNIP+SL+ +T Sbjct: 621 LKELRLLNLSGNSFTSNIPQSLANLT 646 >At1g80080.1 68414.m09374 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 496 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 598 LLNLMILKLTSREITSNIPESLSRV 524 L NLMIL L++ I +IP+SL+R+ Sbjct: 326 LKNLMILVLSNTNIQGSIPKSLTRL 350 >At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator of chromosome condensation (RCC1) family protein identical to zinc finger protein PRAF1 [Arabidopsis thaliana] gi|15811367|gb|AAL08940. Length = 1103 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -1 Query: 190 RKLKLNQVINCLFSKRTLLFQQYLRP 113 ++LKL V + +RT +FQ+YLRP Sbjct: 59 KRLKLASVSKIVPGQRTAVFQRYLRP 84 >At5g42140.1 68418.m05130 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1073 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -1 Query: 190 RKLKLNQVINCLFSKRTLLFQQYLRP 113 ++LKL V + +RT +FQ+YLRP Sbjct: 54 KRLKLATVSKIVPGQRTAVFQRYLRP 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,059,645 Number of Sequences: 28952 Number of extensions: 210349 Number of successful extensions: 471 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -