BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0724.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.07c |phf1|swp1, saf50|PHD finger containing protein Phf1... 28 0.79 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 1.8 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 5.6 SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizo... 25 9.7 >SPCC4G3.07c |phf1|swp1, saf50|PHD finger containing protein Phf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 461 Score = 28.3 bits (60), Expect = 0.79 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 277 TDVPPQSNPRLAVSSNRITREF*TAT 200 T VPP+ +P L+VS NR+ + T T Sbjct: 94 TSVPPEQDPSLSVSFNRLPKSASTKT 119 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 1.8 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 269 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMF 370 Y+C + +S G L SED ++ W K GLI+ F Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQF 162 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 5.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 386 SPYAY*TSGSSQLLPFCSTRGF 321 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1055 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 251 PPGSVLEPDHAGVLNGDERFRHVTTLHAWNE 159 P ++E D A H+T LH WNE Sbjct: 876 PKDKIMEADKARANFTQPGGDHLTLLHIWNE 906 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,225,373 Number of Sequences: 5004 Number of extensions: 43642 Number of successful extensions: 97 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -