BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0723.Seq (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81594-1|CAB04745.1| 908|Caenorhabditis elegans Hypothetical pr... 32 0.50 AC024859-3|AAK29969.2| 871|Caenorhabditis elegans Hypothetical ... 28 8.1 >Z81594-1|CAB04745.1| 908|Caenorhabditis elegans Hypothetical protein T20F10.1 protein. Length = 908 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = -3 Query: 407 HDVVKRRPVNCNTTHYRANWV--PGPPSRSTVSISLISNSRP------LFYTSLVKE 261 H VVK P N ++ N P PP++ST+SI +S R L++TS+ K+ Sbjct: 247 HPVVKAPPPNPTMLNHNKNMAPPPPPPAKSTISIETMSEERKADNIQRLYHTSMDKK 303 >AC024859-3|AAK29969.2| 871|Caenorhabditis elegans Hypothetical protein Y71H2AM.10 protein. Length = 871 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 335 PSRSTVSISLISNSRPLFYTSLV 267 P+ S +I + S SRP FYTSLV Sbjct: 202 PTSSNWTIRVSSASRPFFYTSLV 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,754,421 Number of Sequences: 27780 Number of extensions: 345322 Number of successful extensions: 827 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -