BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0719.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.2 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 3.6 Identities = 10/39 (25%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 158 LVSTMELTSSGKKVLSSPLYATLILGLP--PSLTTXKGQ 48 L ++ +S+G+ V SP+ ++G P P++ +G+ Sbjct: 21 LTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGE 59 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 20.6 bits (41), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 225 VLQ*LSKTSHKDAGTISGLNVLRIINEPTAXAIAYG 332 VL+ + + K A + N II+EPT YG Sbjct: 348 VLRHVQAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,581 Number of Sequences: 438 Number of extensions: 1750 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -