BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0717.Seq (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 23 1.8 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 21 4.0 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.6 bits (46), Expect = 1.8 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 230 CMVCSPSRIIXVIAATICXPPFG 162 C+ C P + +IC PFG Sbjct: 45 CVSCGPGQSGQCFGPSICCGPFG 67 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = -3 Query: 441 DVIQDVMSETTSMAIXSM*YADNCVNXASXANPXVN 334 DV+ D+ ++ T + ++ Y + C+ + P V+ Sbjct: 28 DVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVH 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,207 Number of Sequences: 336 Number of extensions: 1415 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -