BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0714.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 26 0.80 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 26 0.80 EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. 23 9.9 EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. 23 9.9 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 26.2 bits (55), Expect = 0.80 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 393 MAYISSISETQSHHVTSFF*FIA*TSGRAH--SSLGVKWVLSP*IYDVNPAPT 545 + YI ++S T F F+ T+ + S++ +KW SP I +NP T Sbjct: 48 LKYIGTVSLTLCERAYFFLTFLVVTACSIYFISNVYIKWQSSPIIIGLNPIAT 100 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 26.2 bits (55), Expect = 0.80 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 393 MAYISSISETQSHHVTSFF*FIA*TSGRAH--SSLGVKWVLSP*IYDVNPAPT 545 + YI ++S T F F+ T+ + S++ +KW SP I +NP T Sbjct: 48 LKYIGTVSLTLCERAYFFLTFLVVTACSIYFISNVYIKWQSSPIIIGLNPIAT 100 >EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 2 KCVYFLNILNVVK*IISKV*NHL 70 KC+YFL + K S + HL Sbjct: 23 KCLYFLKVFKYTKGTTSNLKRHL 45 >EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 2 KCVYFLNILNVVK*IISKV*NHL 70 KC+YFL + K S + HL Sbjct: 23 KCLYFLKVFKYTKGTTSNLKRHL 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,921 Number of Sequences: 2352 Number of extensions: 10020 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -