BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0713.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0614 + 30621495-30621670,30621817-30622036,30623848-306242... 31 0.92 >01_06_0614 + 30621495-30621670,30621817-30622036,30623848-30624270, 30624523-30624906,30624991-30625086,30625161-30625276, 30625431-30625598,30625685-30625844,30625999-30626196, 30626304-30626432,30626595-30626673,30627010-30627119 Length = 752 Score = 30.7 bits (66), Expect = 0.92 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = -2 Query: 267 RITKFIAFHSQRHLFIVI---LSI*H*CFYKLYEFYRRNLFLIVKLN**LYERESI 109 ++T F AF HLFI++ L + C Y ++ +YRR ++ + + LY E I Sbjct: 363 KLTGFNAFWYSHHLFIIVYIALIVHGECLYLIHVWYRRTTWMYLSVPVCLYVGERI 418 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,007,062 Number of Sequences: 37544 Number of extensions: 193233 Number of successful extensions: 331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -