BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0713.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-46|CAB54455.3| 795|Caenorhabditis elegans Hypothetical p... 29 1.9 AF043699-2|AAB97567.1| 311|Caenorhabditis elegans Ubiquitin-lik... 27 7.7 >Z99281-46|CAB54455.3| 795|Caenorhabditis elegans Hypothetical protein Y57G11C.32 protein. Length = 795 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 306 IIAERLSVNLSTKRITKFIAFHSQRHLFIVILSI*H*CFYKLYEFYRRNL 157 + A RLS+N S R+ + + RHLF + L H K+ E Y++ L Sbjct: 266 LTASRLSINYSLHRVLLLMLRITYRHLFSIALRENHNNLGKIAERYKKLL 315 >AF043699-2|AAB97567.1| 311|Caenorhabditis elegans Ubiquitin-like protease protein 5 protein. Length = 311 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 319 DLYIDHSRKIICQFIYKENNKIYCVSFPEAF 227 D++ RK++CQ + ++ N + C F AF Sbjct: 231 DMFCTRFRKVVCQKLPQQKNSVDCGIFMMAF 261 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,530,308 Number of Sequences: 27780 Number of extensions: 210799 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -