BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0708.Seq (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 3.4 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 7.9 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 3.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 385 IHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 489 +H Q +PG +L+ HPP AS R+S Sbjct: 822 LHHHAAQQPPPGSHPGAQTQPQLSQHPPGASGRSS 856 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 478 WRNSRRGPPRCPSQQLRSLNGEWANCKP 561 WRN + R + ++ EWA+ KP Sbjct: 12 WRNVQAQAQRNTATAXHVIDPEWASAKP 39 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,231 Number of Sequences: 2352 Number of extensions: 10986 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -