BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0705.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5415| Best HMM Match : ROK (HMM E-Value=1.2e-23) 29 2.2 SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) 29 2.2 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_21961| Best HMM Match : FlaE (HMM E-Value=1.2) 27 8.7 SB_3188| Best HMM Match : Hyd_WA (HMM E-Value=2e-13) 27 8.7 >SB_5415| Best HMM Match : ROK (HMM E-Value=1.2e-23) Length = 313 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +1 Query: 235 QKVAERTNLPHFSSNKFNDYRAVWQVAPSYCNHMFVISITYILGHKKFVI 384 Q +AER N+ + +D VW+V Y + ++ITY+L ++ Sbjct: 202 QAIAERVNVHRHDLHTIDDNNPVWKVVGYYLGAL-CLNITYLLSPNLIIL 250 >SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) Length = 570 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = +2 Query: 401 CHCQ*AQLCSPCSYSKK*GCQAMTHYQSFFLLVRWVTSSQPTWC*MVAGTHRYLQRXCAT 580 C+C Q S C Y C M HY + + TS W +A T CAT Sbjct: 461 CYCVALQYRSHCHYYTS--CATMWHYNIAAFAIIYYTSCATVWHYNIAATAIIYYTSCAT 518 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -1 Query: 184 HPEVQ-HTRAL-RELSP-VYTKMSYKIGPSGYT 95 +P+++ H + R LSP +YTK+ K+ P+GYT Sbjct: 394 YPDLRTHNNCMARHLSPRLYTKLKDKVTPNGYT 426 >SB_21961| Best HMM Match : FlaE (HMM E-Value=1.2) Length = 816 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 268 FSSNKFNDYRAVWQVA-PSYCNHMFVISITYILGHKKFVIIVRYPLPLSVSAALQSLLIF 444 FSS F D + ++ P +C ++ YI+ + K + PLP + S+ +S+ Sbjct: 233 FSSATFFDVAVLRCLSSPGWCEEGVYWALQYIIDYLKREFDIPDPLPKATSSMNRSVSCC 292 Query: 445 EEIRV 459 EEI V Sbjct: 293 EEIGV 297 >SB_3188| Best HMM Match : Hyd_WA (HMM E-Value=2e-13) Length = 1389 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 310 VAPSYCNHMFVISITYILGHKKFVIIVRYPLPLSVSAALQSLLIFEE 450 V P Y + + + +LG KFV+ V L L + QS+L+F E Sbjct: 28 VPPVYSPELLAMPVYLLLGFYKFVVTV--TLLLVLQGVTQSVLLFVE 72 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,368,158 Number of Sequences: 59808 Number of extensions: 422295 Number of successful extensions: 749 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -