BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0705.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50270.1 68418.m06225 F-box family protein contains F-box dom... 29 3.1 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 27 7.2 At3g24540.1 68416.m03082 protein kinase family protein contains ... 27 7.2 At5g56390.1 68418.m07039 F-box family protein contains F-box dom... 27 9.5 At1g79000.1 68414.m09212 p300/CBP acetyltransferase-related prot... 27 9.5 At1g16710.1 68414.m02003 TAZ zinc finger family protein / zinc f... 27 9.5 >At5g50270.1 68418.m06225 F-box family protein contains F-box domain Pfam:PF00646 Length = 381 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 240 FLWC*LKSLVYADKLQSIATLKFNIL---GLFVN*APFIRRCHTKL 112 FLW + LVY D Q++ KF+ LF+ AP I H KL Sbjct: 37 FLWMMVPKLVYDDSYQNLEYGKFSRFVDRSLFMRKAPGIETLHFKL 82 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 373 KFVIIVRYPLPLSVSAALQSLLIFEEIRVSSYDALP 480 K +II R+P L + S +FEE ++S + A P Sbjct: 350 KQLIIARFPKLLCIQVQRASFNMFEEFKLSGHIAFP 385 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 342 DIHNIYSRPQKVCYHRPISVAIVSERSFAVLAHIRRN 452 D +N+Y+ V + RP+ V + E +F LA I+ N Sbjct: 380 DANNVYADDSLVDWARPLLVQALEESNFEGLADIKLN 416 >At5g56390.1 68418.m07039 F-box family protein contains F-box domain Pfam:PF00646 Length = 428 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -2 Query: 240 FLWC*LKSLVYADKLQSIATLKFNIL---GLFVN*APFIRRCHTKLVH 106 +LW + SLVY D Q I +F+ L ++ AP I H KL H Sbjct: 37 YLWMMVPSLVYDDSYQDIDYGRFSRFVDRSLALHKAPVIDTLHFKLGH 84 >At1g79000.1 68414.m09212 p300/CBP acetyltransferase-related protein 2 (PCAT2) contains Pfam domains PF02135: TAZ zinc finger and PF00569: Zinc finger, ZZ type; identical to cDNA p300/CBP acetyltransferase-related protein 2 GI:12597460 Length = 1691 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 193 VYCHPEVQHTRALRELSPVYTKMSYKIGPSG 101 +YCHPE+Q T +L Y M K G Sbjct: 1255 LYCHPEIQKTPKSDKLREWYLAMLRKASKEG 1285 >At1g16710.1 68414.m02003 TAZ zinc finger family protein / zinc finger (ZZ type) family protein contains Pfam profiles PF02135: TAZ zinc finger, PF00569: Zinc finger, ZZ type Length = 1706 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 193 VYCHPEVQHTRALRELSPVYTKMSYKIGPSG 101 +YCHPE+Q T +L Y M K G Sbjct: 1270 LYCHPEIQKTPKSDKLREWYLAMLRKAAKEG 1300 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,063,027 Number of Sequences: 28952 Number of extensions: 286957 Number of successful extensions: 514 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -