BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0704.Seq (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0280 + 27435166-27435254,27436348-27436437,27436764-274368... 27 5.5 01_06_1128 - 34724469-34724699,34726103-34726213,34726301-347264... 27 7.2 05_06_0101 - 25581800-25581943,25582030-25582095,25582268-255823... 26 9.5 >02_05_0280 + 27435166-27435254,27436348-27436437,27436764-27436866, 27437318-27437377,27437745-27439148,27439227-27439328, 27439424-27439609,27439695-27439820,27439905-27440000, 27440509-27440574 Length = 773 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 150 NTCNQNSDQ*WDECFY*IKTNRRR 221 N+ N++SDQ +C+Y +KTNR++ Sbjct: 741 NSLNRSSDQ-ISKCYYSLKTNRKQ 763 >01_06_1128 - 34724469-34724699,34726103-34726213,34726301-34726409, 34726517-34726581,34726661-34726838,34726918-34726997, 34727838-34727961,34728064-34728172,34728299-34728461 Length = 389 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 100 FLRSYSVTWITVVILELIHAIRTLTSDGMSAF 195 F+R Y TW + +L+ + TLT S F Sbjct: 241 FIRCYDCTWTLIDEYDLVDPVHTLTPPEESGF 272 >05_06_0101 - 25581800-25581943,25582030-25582095,25582268-25582390, 25582635-25582722,25582823-25582920,25583088-25583147, 25583228-25583288,25583374-25583505,25583957-25584167, 25584515-25584648,25584907-25584989,25585077-25585142, 25585552-25585607,25585701-25585800,25586313-25586421, 25586499-25586653,25586767-25586937,25587129-25587212, 25587261-25587345,25587431-25587477,25587912-25588124 Length = 761 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +2 Query: 200 DQNQSTEGLASE--VVNFDELDNFCRSHG 280 + +Q T G S+ V+ FDE+D C+S G Sbjct: 315 ENDQKTRGDQSDLHVIIFDEIDAICKSRG 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,323,080 Number of Sequences: 37544 Number of extensions: 130177 Number of successful extensions: 243 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -