BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0704.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 0.49 At4g04910.1 68417.m00714 AAA-type ATPase family protein similar ... 30 0.65 At3g05660.1 68416.m00630 disease resistance family protein conta... 29 1.1 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 0.49 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 261 LSNSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 160 +S+S S RPS+DWF N+S + + SS+ Sbjct: 221 VSDSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At4g04910.1 68417.m00714 AAA-type ATPase family protein similar to SP|P18708 Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) {Cricetulus griseus}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; contains non-consensus AT-AC splice sites at intron 2 Length = 742 Score = 29.9 bits (64), Expect = 0.65 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = +2 Query: 200 DQNQSTEGLASE--VVNFDELDNFCRSHG 280 +Q+Q T G ASE V+ FDE+D C+S G Sbjct: 307 EQDQRTLGDASELHVIIFDEIDAICKSRG 335 >At3g05660.1 68416.m00630 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 883 Score = 29.1 bits (62), Expect = 1.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 188 VLLLDQNQSTEGLASEVVNFDELDNFCRSHGQVPXTHXSNV 310 +L LD N+ + L EV+N +L SH Q T N+ Sbjct: 211 ILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNI 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,757,164 Number of Sequences: 28952 Number of extensions: 107518 Number of successful extensions: 190 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -