BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0703.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 28 0.23 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 26 0.94 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 3.8 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 5.0 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 5.0 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 23 8.8 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 27.9 bits (59), Expect = 0.23 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 16 RASLTLWVIKCD--HVASEFASTSWYRHPGSQLAS 114 R S+ I CD H S+ WY+HP ++L+S Sbjct: 311 RPSIPSRWIACDTLHAISKVMKECWYQHPAARLSS 345 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.8 bits (54), Expect = 0.94 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 119 KPTVRERNAAMFNNQLMSDITFIVGAPGHTKI 214 KPT+ ER F + +M+ I IVG G+ I Sbjct: 661 KPTMNERIHERFMDHMMAGIEDIVGKTGNYNI 692 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 90 AVPGGAGELAGDVVALDDPQGEGG 19 AV G G GD V P G GG Sbjct: 509 AVTPGGGRAEGDKVTFQIPNGGGG 532 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 250 FSFYAMFYGGLAECKQ 297 F Y +YG L+EC Q Sbjct: 143 FQCYYQYYGALSECPQ 158 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 250 FSFYAMFYGGLAECKQ 297 F Y +YG L+EC Q Sbjct: 143 FQCYYQYYGALSECPQ 158 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 215 IPAHKYVLATASSASMLCFMEVWQNVNKKLRF 310 +P Y + +LC M + QN+ K L F Sbjct: 126 LPGDDYTECSFIFLYILCTMSIRQNIQKMLGF 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,946 Number of Sequences: 2352 Number of extensions: 11152 Number of successful extensions: 31 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -