BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0701.Seq (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcri... 25 2.0 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 7.9 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 7.9 >AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcription factor protein. Length = 319 Score = 25.0 bits (52), Expect = 2.0 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 551 LXRDRYFCALHSLIRLLWTRGSKRPRTPRLQASAWTRTGLRWRRNKT 411 L D + LH + L+ G+ RPR P L A + + R RR++T Sbjct: 149 LQPDLFAAHLHQQVGLVACNGNFRPRYPFLNADSHIK---RKRRHRT 192 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 76 LHIGVVEGTLRVGDEVHCH 94 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 76 LHIGVVEGTLRVGDEVHCH 94 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 77 LHIGVVEGTLRVGDEVHCH 95 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 77 LHIGVVEGTLRVGDEVHCH 95 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 76 LHIGVVEGTLRVGDEVHCH 94 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 76 LHIGVVEGTLRVGDEVHCH 94 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 60 LHIGVVEGTLRVGDEVHCH 78 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 60 LHIGVVEGTLRVGDEVHCH 78 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 90 LHQLFLASSLRVNDELECH 34 LH + +LRV DE+ CH Sbjct: 90 LHIGVVEGTLRVGDEVHCH 108 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 530 CALHSLIRLLWTRGSKRPR 474 CA+H+L+ W +RPR Sbjct: 329 CAVHALLMATWVFCYERPR 347 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,705 Number of Sequences: 2352 Number of extensions: 10219 Number of successful extensions: 63 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -