BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0699.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 1.6 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 6.6 AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 23 8.8 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 8.8 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 8.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 8.8 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.0 bits (52), Expect = 1.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 456 ARFHPSXQTAHRRSKQNGST--DHHTVSPD 539 ARF PS T+HR S N S+ T PD Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKSTAHPD 373 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 6.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 273 WKFETSKYYVTIIDAPG 323 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 447 ACLARFHPSXQTAHRRSKQNGSTDH 521 ACL ++ S T +GSTD+ Sbjct: 46 ACLVQWESSYSTTATHKNTDGSTDY 70 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 213 LGIGQTKG*A*AWYTIDIALWKFETS 290 +G G+ G A +YT A W++E S Sbjct: 654 VGGGRLNGPADRYYTDPCATWRYEES 679 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = -1 Query: 338 DEISVSRSINDGNIVLASFELPESNIDCIPRSRSAFSLSNTQAYLK 201 DE+ +G + S ++PE ++D PR+ + + + +A L+ Sbjct: 59 DEMERKLRYVEGEVKKDSVQIPECSVDDWPRAPNPREIIDLEARLE 104 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 422 IPASNSPVPAATDEH 378 IPA + PVPA + H Sbjct: 371 IPAGSQPVPAVVNPH 385 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,888 Number of Sequences: 2352 Number of extensions: 10788 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -