BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0695.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) 64 1e-10 SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36) 61 6e-10 SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38) 61 8e-10 SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037) 61 8e-10 SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) 60 1e-09 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 57 1e-08 SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) 49 3e-06 SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) 49 3e-06 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 49 3e-06 SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07) 49 3e-06 SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 49 3e-06 SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) 48 8e-06 SB_40707| Best HMM Match : RVT_1 (HMM E-Value=0.17) 48 8e-06 SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 48 8e-06 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 48 8e-06 SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 48 8e-06 SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 48 8e-06 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_27590| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 46 2e-05 SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40) 46 3e-05 SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) 45 5e-05 SB_41106| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 44 7e-05 SB_142| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_50566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2100| Best HMM Match : PAPA-1 (HMM E-Value=0.75) 44 1e-04 SB_47853| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) 42 3e-04 SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 42 3e-04 SB_36676| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 42 3e-04 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_32853| Best HMM Match : RVT_1 (HMM E-Value=1.6) 42 3e-04 SB_11560| Best HMM Match : Peptidase_M1 (HMM E-Value=0) 42 3e-04 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_4034| Best HMM Match : Exo_endo_phos (HMM E-Value=9.7e-06) 42 5e-04 SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) 42 5e-04 SB_20618| Best HMM Match : PSCyt1 (HMM E-Value=0.64) 41 7e-04 SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 41 7e-04 SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8) 41 7e-04 SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) 41 7e-04 SB_24134| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 41 7e-04 SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) 41 7e-04 SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 41 7e-04 SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) 41 7e-04 SB_3856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 41 9e-04 SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) 40 0.001 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43395| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) 40 0.001 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 40 0.001 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 39 0.003 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 39 0.003 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 39 0.003 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 39 0.003 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 39 0.003 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 39 0.003 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 38 0.005 SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) 38 0.006 SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) 38 0.006 SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_229| Best HMM Match : Ribosomal_L19 (HMM E-Value=4.9) 37 0.011 SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 37 0.011 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 37 0.014 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.033 SB_44839| Best HMM Match : RVT_1 (HMM E-Value=0.071) 36 0.033 SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 36 0.033 SB_5911| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 36 0.033 SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.033 SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.033 SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35) 36 0.033 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.033 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 36 0.033 SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) 36 0.033 SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029) 35 0.043 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.043 SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) 35 0.043 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.043 SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) 35 0.057 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 34 0.076 SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) 34 0.10 SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 34 0.10 SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) 34 0.10 SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) 34 0.10 SB_58186| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 34 0.10 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 34 0.10 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 34 0.10 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 34 0.10 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 34 0.10 SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) 33 0.13 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 33 0.18 SB_48077| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_3422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 33 0.18 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 33 0.23 SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) 33 0.23 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 33 0.23 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 33 0.23 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 33 0.23 SB_50593| Best HMM Match : KIX (HMM E-Value=8) 33 0.23 SB_47521| Best HMM Match : RVT_1 (HMM E-Value=7.2e-24) 33 0.23 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 33 0.23 SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_50245| Best HMM Match : RVT_1 (HMM E-Value=1.4e-16) 32 0.31 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 32 0.31 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 32 0.31 SB_25600| Best HMM Match : RVT_1 (HMM E-Value=0.0074) 32 0.31 SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) 32 0.31 SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) 32 0.31 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 32 0.31 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 32 0.31 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 32 0.31 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.40 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 32 0.40 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 32 0.40 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 32 0.40 SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.40 SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) 32 0.40 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) 32 0.40 SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 32 0.40 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.40 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) 32 0.40 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 31 0.53 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 31 0.53 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 31 0.53 SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) 31 0.53 SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 31 0.53 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 31 0.53 SB_50555| Best HMM Match : Glutaredoxin (HMM E-Value=4.9) 31 0.71 SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 31 0.71 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 31 0.71 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 31 0.71 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) 31 0.71 SB_50448| Best HMM Match : RVT_1 (HMM E-Value=3.7) 31 0.71 SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 31 0.71 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 31 0.71 SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) 31 0.71 SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_5801| Best HMM Match : UvdE (HMM E-Value=2.2) 31 0.71 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.71 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.93 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.93 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.93 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 0.93 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 31 0.93 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 31 0.93 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 31 0.93 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 31 0.93 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 31 0.93 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 0.93 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 31 0.93 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 31 0.93 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 31 0.93 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 31 0.93 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.93 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 31 0.93 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 30 1.2 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 30 1.2 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 30 1.2 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 30 1.2 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.2 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 30 1.2 SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) 30 1.2 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 30 1.2 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 30 1.2 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 30 1.2 SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) 30 1.2 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 30 1.2 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 30 1.2 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 30 1.2 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 30 1.2 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 30 1.2 SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) 30 1.2 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 30 1.2 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 30 1.6 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 30 1.6 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 30 1.6 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 30 1.6 SB_24622| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-17) 30 1.6 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 30 1.6 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 30 1.6 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_6749| Best HMM Match : RVT_1 (HMM E-Value=0.069) 30 1.6 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 30 1.6 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 30 1.6 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 30 1.6 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) 30 1.6 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 30 1.6 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 30 1.6 SB_36959| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 30 1.6 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 30 1.6 SB_25230| Best HMM Match : NACHT (HMM E-Value=0.0015) 30 1.6 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 30 1.6 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) 30 1.6 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) 30 1.6 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 29 2.2 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 29 2.2 SB_55228| Best HMM Match : RVT_1 (HMM E-Value=0.028) 29 2.2 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 29 2.2 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 29 2.2 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.2 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 29 2.2 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 29 2.2 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 29 2.2 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 2.2 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 29 2.2 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 29 2.2 SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) 29 2.2 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 29 2.2 SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) 29 2.2 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 29 2.2 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.2 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 29 2.2 SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 29 2.2 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 29 2.2 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.2 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_50062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_48616| Best HMM Match : RVT_1 (HMM E-Value=2.8e-26) 29 2.2 SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) 29 2.2 SB_44569| Best HMM Match : Gal_Lectin (HMM E-Value=4.5) 29 2.2 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 29 2.2 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 29 2.2 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 29 2.2 SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) 29 2.2 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.2 SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 29 2.2 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.2 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 29 2.2 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 29 2.2 SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 29 2.2 SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) 29 2.9 SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) 29 2.9 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.9 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 29 2.9 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_20480| Best HMM Match : RVT_1 (HMM E-Value=0.00014) 29 2.9 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 29 2.9 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 29 2.9 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 29 2.9 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 29 2.9 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 29 2.9 SB_15469| Best HMM Match : RVT_1 (HMM E-Value=0.00014) 29 2.9 SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_47014| Best HMM Match : rve (HMM E-Value=6.8e-21) 29 3.8 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 29 3.8 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 29 3.8 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 29 3.8 SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_15983| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 29 3.8 SB_144| Best HMM Match : rve (HMM E-Value=3.6e-21) 29 3.8 SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_48424| Best HMM Match : PSI (HMM E-Value=0.4) 29 3.8 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 29 3.8 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 29 3.8 SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) 29 3.8 SB_4370| Best HMM Match : PSI (HMM E-Value=0.4) 29 3.8 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 29 3.8 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 28 5.0 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 28 5.0 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 28 5.0 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_40446| Best HMM Match : RVT_1 (HMM E-Value=2.2e-16) 28 5.0 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 28 5.0 SB_36393| Best HMM Match : IF2_N (HMM E-Value=5.1) 28 5.0 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 5.0 SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9) 28 5.0 SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_20736| Best HMM Match : DUF1628 (HMM E-Value=9.4) 28 5.0 SB_16148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 28 5.0 SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) 28 5.0 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 5.0 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) 28 5.0 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 28 5.0 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 28 5.0 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 28 5.0 SB_15381| Best HMM Match : Homoserine_dh (HMM E-Value=6.8) 28 5.0 SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) 28 5.0 SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 28 5.0 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 28 5.0 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 28 5.0 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 28 5.0 SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) 28 6.6 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 28 6.6 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 28 6.6 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 28 6.6 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 28 6.6 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 28 6.6 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 28 6.6 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 6.6 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 28 6.6 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 28 6.6 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 28 6.6 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 27 8.7 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 27 8.7 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37999| Best HMM Match : RVT_1 (HMM E-Value=7.5e-10) 27 8.7 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 27 8.7 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_34404| Best HMM Match : MtrG (HMM E-Value=6) 27 8.7 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 27 8.7 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 27 8.7 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 27 8.7 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 27 8.7 SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_15673| Best HMM Match : Arc_PepC_II (HMM E-Value=1.4) 27 8.7 SB_13555| Best HMM Match : B5 (HMM E-Value=1.4) 27 8.7 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 SB_56671| Best HMM Match : RVT_1 (HMM E-Value=9.3e-08) 27 8.7 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 27 8.7 SB_32160| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 27 8.7 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.7 SB_15609| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 27 8.7 SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 27 8.7 SB_5882| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 335 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/75 (37%), Positives = 51/75 (68%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG+ QGS LSP+LFI+++ AL+ D++ PW +L+A+++V+ + +L K+ Sbjct: 37 VKVGVHQGSVLSPFLFIVVLEALSADLRSGCPWELLYADDLVISSDSLDTLLAKLCMWKQ 96 Query: 71 RLENVGMKISRTKTE 27 LE+ G++++ +KTE Sbjct: 97 GLESKGLRVNMSKTE 111 >SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36) Length = 1346 Score = 61.3 bits (142), Expect = 6e-10 Identities = 27/75 (36%), Positives = 50/75 (66%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG+ QGS LSP+LFI+++ AL+ D + PW +L+A+++V+ + +L K+ Sbjct: 1157 VQVGVHQGSVLSPFLFIVVLEALSADFRSGCPWELLYADDLVISSDSLDTLLAKLGMWKQ 1216 Query: 71 RLENVGMKISRTKTE 27 LE+ G++++ +KT+ Sbjct: 1217 GLESKGLRVNMSKTK 1231 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/70 (32%), Positives = 36/70 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R + W M G+P + I+A Sbjct: 1079 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRVISWLAMCRLGLPEWFISTIQA 1136 Query: 307 THGRTSTYVC 278 + S+ VC Sbjct: 1137 MYSHASSRVC 1146 >SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38) Length = 622 Score = 60.9 bits (141), Expect = 8e-10 Identities = 27/75 (36%), Positives = 50/75 (66%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG+ QGS LSP+LFI+++ AL+ D++ PW +L+A+++V+ + +L K+ Sbjct: 298 VQVGVHQGSVLSPFLFIVVLEALSADLRSGCPWELLYADDLVISSDSLDTLLAKLCMWKQ 357 Query: 71 RLENVGMKISRTKTE 27 LE+ G+ ++ +KT+ Sbjct: 358 GLESKGLHVNMSKTK 372 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/77 (32%), Positives = 41/77 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R +LW M+ G+P + I+A Sbjct: 220 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRDILWWAMRCLGLPEWFISTIKA 277 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + N+ Sbjct: 278 MYSHASSRVCVSNSLND 294 >SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037) Length = 214 Score = 60.9 bits (141), Expect = 8e-10 Identities = 27/75 (36%), Positives = 50/75 (66%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG+ QGS LSP+LFI+++ AL D++ PW +L+A+++V+ + +L K+ Sbjct: 91 VKVGVHQGSVLSPFLFIVVLEALFADLRSGCPWELLYADDLVISSDSLDTLLAKLCMWKQ 150 Query: 71 RLENVGMKISRTKTE 27 LE+ G++++ +KT+ Sbjct: 151 GLESKGLRVNMSKTK 165 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/77 (29%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V +LW M+ G+P + I+A Sbjct: 13 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPHVILWWAMRRLGLPEWFVSTIQA 70 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + ++ Sbjct: 71 MYSHASSRVCVSNSLSD 87 >SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) Length = 262 Score = 60.1 bits (139), Expect = 1e-09 Identities = 27/75 (36%), Positives = 50/75 (66%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG+ QGS LSP+LFI+++ AL+ D++ PW +L+A+++V+ + +L K+ Sbjct: 156 VQVGVHQGSVLSPFLFIVVLEALSADLRSGCPWELLYADDLVISSDSLDALLAKLCMWKQ 215 Query: 71 RLENVGMKISRTKTE 27 LE+ G+ ++ +KT+ Sbjct: 216 GLESKGLCVNMSKTK 230 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 + FVDLEKAFD V R ++W M+ G+ + I+A + S+ VC + ++ Sbjct: 97 LFFAFVDLEKAFDRVPRDIIWWAMRRLGLSEWFVSTIQAMYSHASSRVCVSNSLSD 152 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/76 (32%), Positives = 48/76 (63%) Frame = -3 Query: 248 VVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KER 69 V+ + QGS LSP LFI+++ AL+ D++ PW +L+A+++V+ + +L K Sbjct: 280 VIPVEQGSVLSPLLFIIVLEALSCDLRRGCPWELLYADDLVIASDSLENLQQKLMLWKTG 339 Query: 68 LENVGMKISRTKTEHM 21 +E+ G++++ KT+ M Sbjct: 340 MESKGLRVNMKKTKVM 355 >SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/75 (34%), Positives = 48/75 (64%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERPEA*MRLAK*KE 72 V VG QGS LS +LFI+++ AL+ D + PW +L+A+++V+ + +L K+ Sbjct: 693 VQVGAHQGSVLSLFLFIVVLEALSADFRSGCPWELLYADDLVISSDSLDTLLAKLGMWKQ 752 Query: 71 RLENVGMKISRTKTE 27 LE+ G++++ +KT+ Sbjct: 753 GLESKGLRVNMSKTK 767 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/77 (31%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R +LW M G+P + I+A Sbjct: 615 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRVILWWAMCRLGLPEWFVSTIQA 672 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + ++ Sbjct: 673 MYSHASSRVCVSNSLSD 689 >SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) Length = 318 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 74 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 131 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 132 FHDGMMARVLDNGNTS 147 >SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) Length = 343 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 6 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 63 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 64 FHDGMMARVLDDGNTS 79 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 87 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 115 >SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 470 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 133 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 190 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 191 FHDGMMARVLDDGNTS 206 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 214 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 242 >SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 48.8 bits (111), Expect = 3e-06 Identities = 29/77 (37%), Positives = 41/77 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V A R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 121 DMVFAVRRIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 178 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 179 FHDDMTGEVLSDGEPSE 195 >SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 119 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 176 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 177 FHDGMMARVLDDGNTS 192 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 200 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 228 >SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 68 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 125 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 126 FHDGMMARVLDDGNTS 141 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 149 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 177 >SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07) Length = 278 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 34 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 91 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 92 FHDGMMARVLDDGNTS 107 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 115 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 143 >SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 15 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 72 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 73 FHDGMMARVLDDGNTS 88 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 96 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 124 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 48.8 bits (111), Expect = 3e-06 Identities = 28/77 (36%), Positives = 39/77 (50%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 EK + R+ E Q ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 2941 EKNLPESQRQIQEKCLEQNMNLYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 3000 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 3001 FHDDMTGEVLSDGEPSE 3017 >SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 425 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + A+R +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R Sbjct: 74 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQ 131 Query: 307 THGRTSTYVCSAGDTN 260 H V G+T+ Sbjct: 132 FHDGMMARVLDDGNTS 147 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAP 156 G+ QG L+P LF L+ A+ TD E P Sbjct: 155 GVKQGCVLAPTLFSLMFSAMLTDAFRETP 183 >SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) Length = 309 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 29 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 86 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 87 FHDDMTGEVLSDGEPSE 103 >SB_40707| Best HMM Match : RVT_1 (HMM E-Value=0.17) Length = 208 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 29 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 86 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 87 FHDDMTGEVLSDGEPSE 103 >SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 629 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 217 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 274 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 275 FHDDMTGEVLSDGEPSE 291 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 531 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 588 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 589 FHDDMTGEVLSDGEPSE 605 >SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 963 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 545 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 602 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 603 FHDDMTGEVLSDGEPSE 619 >SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 869 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 477 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 534 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 535 FHDDMTGEVLSDGEPSE 551 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/77 (36%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 370 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 427 Query: 307 THGRTSTYVCSAGDTNE 257 +H + V S G +E Sbjct: 428 SHDDMTGEVLSDGKPSE 444 >SB_27590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/77 (32%), Positives = 41/77 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R +LW M+ G+P + I+A Sbjct: 108 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRDILWWAMRRLGLPEWFVSTIQA 165 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + N+ Sbjct: 166 MYSHASSRVCVSSSLND 182 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/77 (35%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V + R +E + QN ++ F+DL KAFD V R+ LW + G P K+ LIR Sbjct: 713 DMVFSVRQIQEKCLEQNMN--LYAFFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 770 Query: 307 THGRTSTYVCSAGDTNE 257 H + V S G+ +E Sbjct: 771 FHDDMTGEVLSDGEPSE 787 >SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40) Length = 380 Score = 45.6 bits (103), Expect = 3e-05 Identities = 27/77 (35%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + V R +E + QN ++ VF+DL KAFD V R+ LW + G P K+ LIR Sbjct: 121 DMVFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKFTTLIRL 178 Query: 307 THGRTSTYVCSAGDTNE 257 + + V S G+ +E Sbjct: 179 LYDDMTGEVLSDGEPSE 195 >SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) Length = 317 Score = 44.8 bits (101), Expect = 5e-05 Identities = 19/43 (44%), Positives = 31/43 (72%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V VG QGS LS +LFI+++ AL+ D + PW +L+A+++V+ Sbjct: 261 VQVGAHQGSVLSLFLFIVVLEALSADFRSGCPWELLYADDLVI 303 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/77 (31%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R +LW M G+P + I+A Sbjct: 183 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRVILWWAMCRLGLPEWFVSTIQA 240 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + ++ Sbjct: 241 MYSHASSRVCVSNSLSD 257 >SB_41106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 44.4 bits (100), Expect = 7e-05 Identities = 23/56 (41%), Positives = 28/56 (50%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ FVDL KAFD V R LW M G P K+ L+RA H V G +E Sbjct: 29 LYTTFVDLSKAFDTVSRAGLWKIMSKHGCPEKFITLVRAIHNGMQVRVMGDGGASE 84 >SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) Length = 959 Score = 44.4 bits (100), Expect = 7e-05 Identities = 25/67 (37%), Positives = 36/67 (53%) Frame = -1 Query: 460 EESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 +E V QNQ ++ FVDL KAFD V R+ LW M G P ++ +++R H V Sbjct: 621 QEKSVEQNQD--LYTTFVDLTKAFDTVSREGLWKIMAKFGCPERFIKIVRQFHDGMMARV 678 Query: 280 CSAGDTN 260 G+T+ Sbjct: 679 LDDGNTS 685 >SB_142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.0 bits (99), Expect = 9e-05 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 93 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNIIRS 150 Query: 307 THGRTSTYVCSAGDTNE 257 H V G+ ++ Sbjct: 151 LHSGMKASVSQGGNDSK 167 >SB_50566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 2 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRS 59 Query: 307 THGRTSTYVCSAGDTNE 257 H V G+ ++ Sbjct: 60 LHSGMKASVSQGGNDSK 76 >SB_2100| Best HMM Match : PAPA-1 (HMM E-Value=0.75) Length = 403 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 318 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRS 375 Query: 307 THGRTSTYVCSAGDTNE 257 H V G+ ++ Sbjct: 376 LHSGMKASVSQGGNDSK 392 >SB_47853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 1431 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVEFGCPPKFVNVIRS 1488 Query: 307 THGRTSTYVCSAGDTNE 257 H V G+ ++ Sbjct: 1489 LHSGMKASVSQGGNDSK 1505 >SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 93 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRS 150 Query: 307 THGRTSTYVCSAGDTNE 257 H V G+ ++ Sbjct: 151 LHSGMKASVSQGGNDSK 167 >SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) Length = 372 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 6 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 65 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 66 VQDNGETS 73 >SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 455 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 6 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 65 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 66 VQDNGETS 73 >SB_36676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 92 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 151 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 152 VQDNGETS 159 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 643 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 702 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 703 VQDNGETS 710 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 683 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 742 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 743 VQDNGETS 750 >SB_32853| Best HMM Match : RVT_1 (HMM E-Value=1.6) Length = 358 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 226 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 285 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 286 VQDNGETS 293 >SB_11560| Best HMM Match : Peptidase_M1 (HMM E-Value=0) Length = 854 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 547 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 606 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 607 VQDNGETS 614 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 548 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLAS 607 Query: 283 VCSAGDTN 260 V G+T+ Sbjct: 608 VQDNGETS 615 >SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 41.9 bits (94), Expect = 4e-04 Identities = 23/77 (29%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD R +LW M+ G+P + I+A Sbjct: 13 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRFPRDILWWAMRRLGLPEWFVSTIQA 70 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + ++ Sbjct: 71 MYSHASSRVCVSNSLSD 87 >SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/60 (35%), Positives = 34/60 (56%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNELVWW 245 +++ F+D EKAFD V R+ LW M+ GVP K R++R + + C+ D ++ W Sbjct: 280 LYVNFIDFEKAFDSVHRESLWVIMEKYGVPEKIIRIVRLFY---EDFQCAVEDQGKIGEW 336 >SB_4034| Best HMM Match : Exo_endo_phos (HMM E-Value=9.7e-06) Length = 609 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/77 (31%), Positives = 40/77 (51%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E +++ + F FVDLEKAFD V R +LW M G+P + I+A Sbjct: 532 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRVILWWAMCRLGLPEWFVSTIQA 589 Query: 307 THGRTSTYVCSAGDTNE 257 + S+ VC + ++ Sbjct: 590 MYSHASSRVCVSNSLSD 606 >SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) Length = 368 Score = 41.5 bits (93), Expect = 5e-04 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 +++ F+D EKAFD V R+ LW M+ GVP K R++R + V G+T E Sbjct: 259 LYVNFIDFEKAFDSVDRESLWVIMEKYGVPEKIIRIVRLFYEDFQCAVEDQGETGE 314 >SB_20618| Best HMM Match : PSCyt1 (HMM E-Value=0.64) Length = 266 Score = 41.1 bits (92), Expect = 7e-04 Identities = 21/62 (33%), Positives = 33/62 (53%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 + + R +E + QN ++ VF+D KAFD V R+ LW + G P K+ +IR+ Sbjct: 205 DMIFCLRQTQEKCIEQNMP--LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRS 262 Query: 307 TH 302 H Sbjct: 263 LH 264 >SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 268 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 3 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 58 >SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8) Length = 268 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 3 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 58 >SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) Length = 307 Score = 41.1 bits (92), Expect = 7e-04 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = -1 Query: 511 HSHSTKAWEKVIASRMREESEVSQ--NQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGV 338 H W+K + ++ ++ + + + G + VD E+AFD V R+ LW M+ GV Sbjct: 183 HETIPNDWKKGLIIKLPKKGNLKECKDSRGITLLSIVDFEEAFDSVHRESLWMIMEKYGV 242 Query: 337 PGKYQRLIRATHGRTSTYVCSAGDTNE 257 P K R++R + V G+T E Sbjct: 243 PEKIIRIVRLFYEDFQCAVEDPGETGE 269 >SB_24134| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 268 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 3 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 58 >SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) Length = 426 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 71 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 126 >SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 1582 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 1230 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 1285 >SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) Length = 416 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 165 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 220 >SB_3856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 ++ VF+D KAFD V R+ LW + G P K+ +IR+ H V G+ ++ Sbjct: 110 LYAVFIDFSKAFDTVSREALWQVLVKFGCPPKFVNVIRSLHSGMKASVSQGGNDSK 165 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS LSP LF+L + ++T IQ LFA++ VL E Sbjct: 667 SVVSGVPQGSVLSPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 710 >SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 576 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/64 (35%), Positives = 32/64 (50%) Frame = -1 Query: 451 EVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSA 272 E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H V Sbjct: 200 EKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLASVQDN 259 Query: 271 GDTN 260 G+T+ Sbjct: 260 GETS 263 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEI 129 G+ QG L+P LF L+ A+ TD+ + C F +I Sbjct: 271 GVKQGCVLAPTLFSLLFSAMLTDVLKMMSACKNFGLKI 308 >SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) Length = 404 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 +++ F+D EKAFD V R+ LW M+ GVP K R++R V G+T E Sbjct: 234 LYVNFIDFEKAFDSVHRESLWVIMEKYGVPEKIIRIVRLFCEDFQRAVEDQGETGE 289 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 ++ E Q Q + FVDL KAFD V R LW M G P ++ ++R H + Sbjct: 157 KQLQEKCQEQHTALFTTFVDLTKAFDTVSRSGLWTIMGKFGCPPRFTSMVRQFHDGMQAH 216 Query: 283 VCSAGD 266 V G+ Sbjct: 217 VLEDGN 222 >SB_43395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ ++R H Sbjct: 165 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLH 218 >SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) Length = 906 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 ++ E Q Q + FVDL KAFD V R LW M G P ++ ++R H + Sbjct: 422 KQLQEKCQEQHTALFTTFVDLTKAFDTVSRSGLWTIMGKFGCPPRFTSMVRQFHDGMQAH 481 Query: 283 VCSAGD 266 V G+ Sbjct: 482 VLEDGN 487 >SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) Length = 565 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTY 284 ++ E Q Q + FVDL KAFD V R LW M G P ++ ++R H + Sbjct: 117 KQLQEKCQEQHTALFTTFVDLTKAFDTVSRSGLWTIMGKFGCPPRFTSMVRQFHDGMQAH 176 Query: 283 VCSAGD 266 V G+ Sbjct: 177 VLEDGN 182 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 111 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 154 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 111 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 154 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 27 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 70 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 425 SVVPGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 468 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 111 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 154 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 555 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 598 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 224 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 267 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/41 (43%), Positives = 27/41 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 +++ F+D EKAFD V R+ LW M+ GVP K +IR ++ Sbjct: 126 LYVNFIDYEKAFDSVDRQTLWRLMRHYGVPEKITNIIRKSY 166 >SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) Length = 585 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/41 (43%), Positives = 27/41 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 +++ F+D EKAFD V R+ LW M+ GVP K +IR ++ Sbjct: 194 LYVNFIDYEKAFDSVDRQTLWRLMRHYGVPEKITNIIRKSY 234 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 27 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 70 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 525 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 568 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGE 114 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL E Sbjct: 322 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVLYRE 365 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/44 (47%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SVV G+PQGS L P LF+L + ++T IQ LFA++ VL Sbjct: 53 SVVSGVPQGSVLGPVLFLLFINDISTSIQSN---LRLFADDCVL 93 >SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) Length = 534 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 +++ F+D EKAFD V R+ LW ++ GVP K +IR ++ Sbjct: 18 LYVNFIDYEKAFDSVDRQTLWRLLRHYGVPEKITNIIRKSY 58 >SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 +++ F+D EKAFD V R+ LW ++ GVP K +IR ++ Sbjct: 232 LYVNFIDYEKAFDSVDRQTLWRLLRHYGVPEKITNIIRKSY 272 >SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) Length = 203 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = -1 Query: 415 VFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNELVWW 245 + D EKAFD V R+ LW M+ GVP K R+++ + + C+ D E+ W Sbjct: 26 MLADFEKAFDSVHRESLWVIMEKYGVPEKIIRIVKLFY---EDFQCAVEDQGEIGEW 79 >SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 +++ F+D EKAFD V R+ LW ++ GVP K +IR ++ Sbjct: 93 LYVNFIDYEKAFDSVDRQTLWRLLRHYGVPEKITNIIRKSY 133 >SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -1 Query: 400 EKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 EKAFD V RK LW M+ GVP K R++R + V G+T E Sbjct: 3 EKAFDSVHRKSLWVIMEKYGVPEKIIRIVRLFYEDFQCEVEDQGETGE 50 >SB_229| Best HMM Match : Ribosomal_L19 (HMM E-Value=4.9) Length = 229 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/58 (36%), Positives = 33/58 (56%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNELV 251 +HM FVD++KAFD V + + ++ GVP IR + R+ST + AG ++ V Sbjct: 167 LHMAFVDVKKAFDSVSHETVVIALQRLGVPSPLISYIRDLYNRSSTILEFAGCRSDSV 224 >SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 519 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 +++ F+D EKAF+ V R+ LW M+ GVP K ++R + V G+T E Sbjct: 356 LYVNFIDFEKAFNSVHRESLWVIMEKYGVPEKIICIVRLFYEDFQCAVEDQGETGE 411 >SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/58 (36%), Positives = 33/58 (56%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNELV 251 +HM FVD++KAFD V + + ++ GVP IR + R+ST + AG ++ V Sbjct: 108 LHMAFVDVKKAFDSVSHETVVIALQRLGVPSPLISYIRDLYNRSSTILEFAGCRSDSV 165 >SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 855 Score = 36.7 bits (81), Expect = 0.014 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTN 260 ++ +V L KAFD V R+ LW M G P K+ ++R H V G+T+ Sbjct: 419 LYSTYVGLTKAFDTVSREGLWKIMAKFGCPSKFINIVRQLHDGMLASVQDNGETS 473 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 36.3 bits (80), Expect = 0.019 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 317 YSSYAR*NQYVRMLRWRYQRV-SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCM 147 + SY + M+ W + ++ G+PQGS L P LF++ +Y L + + P CM Sbjct: 51 FQSYLSNRKQQCMVNWHLSKPRTITCGVPQGSILGPLLFLIYIYDLPNCLLQTTP-CM 107 >SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 559 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 213 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 264 >SB_44839| Best HMM Match : RVT_1 (HMM E-Value=0.071) Length = 351 Score = 35.5 bits (78), Expect = 0.033 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = -1 Query: 481 VIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLI 314 V R +E + QN ++ VF+DL KAFD V R+ LW + G P K I Sbjct: 106 VFTVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILSKLGCPAKVYNAI 159 >SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTN 260 +++ F+D KAFD V R+ LW ++ G+P K LI + S + CS N Sbjct: 913 LYINFIDFRKAFDSVHRETLWKILESYGIPNKIITLINLFY---SNFECSVITNN 964 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 424 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 475 >SB_5911| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 304 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTN 260 +++ F+D KAFD V R+ LW ++ G+P K LI + S + CS N Sbjct: 236 LYINFIDFRKAFDSVHRETLWKILESYGIPNKIITLINLFY---SNFECSVITNN 287 >SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 18 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 69 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 261 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 312 >SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 388 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 133 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFLILGKLGCPPKFISIIK 184 >SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35) Length = 360 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 146 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 197 >SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 636 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 222 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFLILGKLGCPPKFISIIK 273 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 18 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 69 >SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) Length = 378 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 261 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 312 >SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029) Length = 298 Score = 35.1 bits (77), Expect = 0.043 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -1 Query: 406 DLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 D EKAFD + R++LW +K G+P K ++I+ + V G +E Sbjct: 105 DFEKAFDSIDREMLWKILKHYGIPSKILKMIQVIYDGFQARVLFEGKMSE 154 Score = 29.9 bits (64), Expect = 1.6 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 12/86 (13%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEE-----------APWCMLFANEIVLVGEERPEA* 96 G+ +G LSP LF++++ +TT EE P + FA++IVL+ ++ A Sbjct: 161 GVRKGCLLSPLLFLIVLDWMTTQAYEENKTGIQFSLMTKPEDLEFADDIVLLSQKIAHAR 220 Query: 95 MRL-AK*KERLENVGMKISRTKTEHM 21 + A KE + G+K+ KT+ M Sbjct: 221 NKFEALQKEAAK--GLKVKNIKTKKM 244 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 315 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFLILGKLGCPPKFISVIK 366 >SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) Length = 683 Score = 35.1 bits (77), Expect = 0.043 Identities = 18/52 (34%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VF+D KAFD V R++L+ + G P K+ +I+ Sbjct: 612 LRQLMEKTREQRNNMYIVFIDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 663 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 +R+ E ++ Q M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 136 LRQLMEKTREQRNNMYIVFVDFVKAFDTVNRELLFLILGKLGCPPKFISVIK 187 >SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = -1 Query: 463 REESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKY 326 R+ E Q Q ++ +VDL KAFD V R+ LW M G P K+ Sbjct: 414 RQLQEKCQEQNVDLYSTYVDLTKAFDTVSREGLWKIMAKFGCPSKF 459 >SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 35.1 bits (77), Expect = 0.043 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 +++ F+D +KAFD + R LW ++ GVP K LI + V G +E Sbjct: 68 LYINFIDFKKAFDSLHRNTLWKILRYYGVPSKLVTLIELFYQHFECSVILDGHLSE 123 >SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) Length = 602 Score = 34.7 bits (76), Expect = 0.057 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = -3 Query: 257 VSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIV 126 ++V G+PQG+ LSP LF L + + DI E P LFA++ + Sbjct: 538 LTVKSGVPQGTVLSPVLFSLFINDIVKDIDSEIP---LFADDCI 578 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 34.3 bits (75), Expect = 0.076 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R+ +S G+PQG+ L+P LF +++ L D Q Sbjct: 323 SQYVKIRDSRFHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 365 >SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) Length = 250 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -1 Query: 406 DLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 D EKAFD + R++LW +K G+P K ++I+ + Sbjct: 121 DFEKAFDSIDREMLWKILKHYGIPSKILKMIQVIY 155 >SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1950 Score = 33.9 bits (74), Expect = 0.10 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 1/95 (1%) Frame = -1 Query: 544 TGMRQL*GNKAHSHSTKAWEKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVL 365 +G ++ G A + S W + + RE+ + + F+DL KAFD V R L Sbjct: 84 SGTKKSEGEHADAISDLTWRIELQEKCREQQRP-------LFVAFIDLTKAFDSVSRDGL 136 Query: 364 W*NMKVRGVPGKYQRLIRATH-GRTSTYVCSAGDT 263 + + + G P K I++ H G T C + + Sbjct: 137 FHILPLVGCPPKLLNFIKSFHDGTRGTVKCESNSS 171 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 243 LRQLQEKCREQERPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 302 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 303 TVKCESNSS 311 >SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) Length = 308 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 5 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 64 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 65 TVKCESNSS 73 >SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTT 177 G+PQG LSPYLF+L M + TT Sbjct: 65 GVPQGGVLSPYLFLLFMSSRTT 86 >SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) Length = 385 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 38 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 97 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 98 TVKCESNSS 106 >SB_58186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 33.9 bits (74), Expect = 0.10 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = -1 Query: 481 VIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 V A R +E + QN ++ VF+DL KAFD V R+ LW ++ +GV Y + + Sbjct: 462 VFAVRQIQEKCLEQNMN--LYAVFIDLTKAFDTVNREALWIILR-KGVLRLYGPALTSRR 518 Query: 301 GRTSTY 284 G + + Sbjct: 519 GSSMAW 524 >SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) Length = 545 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 435 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 494 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 495 TVKCESNSS 503 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 72 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 131 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 132 TVKCESNSS 140 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 2163 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHEGTCG 2222 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 2223 TVKCESNSS 2231 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 365 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 424 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 425 TVKCESNSS 433 >SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) Length = 381 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 198 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 257 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 258 TVKCESNSS 266 >SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) Length = 421 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -1 Query: 412 FVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 F+D EKAFD V R+ LW ++ GV K +IR ++ Sbjct: 58 FIDYEKAFDSVDRQTLWRLLRHYGVSEKITNIIRKSY 94 >SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) Length = 889 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 639 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 698 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 699 TVKCESNSS 707 >SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) Length = 352 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTST 287 +R+ E + Q + + ++DL KAFD V R ++ + + G P K I++ H T Sbjct: 128 LRQLQEKCREQQRPLFVAYIDLTKAFDSVSRDGMFHILPLVGCPPKLLNFIKSFHDGTRG 187 Query: 286 YVCSAGDTNE 257 V G+++E Sbjct: 188 TVKCEGNSSE 197 >SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGK 329 +++ F+D EKAFD V R+ LW ++ GVP K Sbjct: 499 LYINFIDYEKAFDSVDRQTLWRLLRHYGVPEK 530 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 33.1 bits (72), Expect = 0.18 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 283 LRQLQEKCREQQRPIFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTHG 342 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 343 TVKCESNSS 351 >SB_48077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 33.1 bits (72), Expect = 0.18 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -1 Query: 406 DLEKAFDWVFR---KVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNE 257 DLEKAFD V R +LW M+ G+P + I+A + S+ VC + ++ Sbjct: 263 DLEKAFDRVDRVPRDILWWAMRRLGLPEWFVSTIQAMYSHASSRVCVSNSLSD 315 >SB_3422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1270 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 412 FVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH 302 F+D KAFD + R+ L+ ++ GV GK+ L++ H Sbjct: 834 FIDFSKAFDTIPRERLFKKVQKSGVTGKFLSLLKTVH 870 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 33.1 bits (72), Expect = 0.18 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 427 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGIRG 486 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 487 TVKCESNSS 495 >SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) Length = 235 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 F+ +VD KAFD V R L+ +K GV G++ +I++ + + V Sbjct: 91 FLFACYVDFSKAFDCVPRAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSV 139 >SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) Length = 730 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +2 Query: 284 VRTGSTVRSSNKPLVFPWHPSHFHVSPQNLTENPIKRFFQINKHHVHEP 430 V T + + +S+KPL H H H PQ L+ +P + N+H P Sbjct: 553 VNTTTIIVTSSKPLSHHHHHHHPHELPQPLSSSPSSHYHSHNQHIRRSP 601 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 83 SQYVKIRDSRSHVISPKEGIPQGTRLAPLLFAILVNRLARDWQ 125 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 723 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILLNRLARDWQ 765 >SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 F+ +VD KAFD V R L+ +K GV G++ +I++ + + V Sbjct: 12 FLFACYVDFSKAFDCVPRAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSV 60 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + + F+DL KAFD V R L+ + G P K I++ H G Sbjct: 237 LRQLQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPSVGCPPKLLNFIKSFHDGTRG 296 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 297 TVKCESNSS 305 >SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) Length = 805 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/77 (25%), Positives = 38/77 (49%) Frame = -3 Query: 347 ERGAREIPAAYSSYAR*NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 ++G + + + Y + NQ V + + V G+PQG+ L P +F+L + + + I Sbjct: 579 KKGNKSLASNYRPISLTNQTVVVEGETSKSTRVTSGVPQGTVLGPLMFLLFINDINSGIT 638 Query: 167 EEAPWCMLFANEIVLVG 117 LFA++ +L G Sbjct: 639 SR---IRLFADDTILYG 652 >SB_50593| Best HMM Match : KIX (HMM E-Value=8) Length = 139 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 F+ +VD KAFD V R L+ +K GV G++ +I++ + + V Sbjct: 12 FLFACYVDFSKAFDCVPRAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSV 60 >SB_47521| Best HMM Match : RVT_1 (HMM E-Value=7.2e-24) Length = 338 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = -1 Query: 412 FVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNEL 254 F+D KAFD + R+ L+ ++ GV GK+ L++ + + V G +E+ Sbjct: 48 FIDFSKAFDTIPRERLFEKVQKSGVTGKFLSLLKTMYDSDNAAVKVNGQVSEV 100 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SV G+PQG+ L P LF+L + L +I +P LFA++ +L Sbjct: 591 SVTSGVPQGTVLGPLLFLLFVNDLPLNI---SPTIRLFADDCLL 631 >SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 704 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 746 >SB_50245| Best HMM Match : RVT_1 (HMM E-Value=1.4e-16) Length = 311 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTN 260 + +VF+D++KAFD V + L K GVPG I + R+ T G+++ Sbjct: 61 LKLVFLDVKKAFDSVSHESLLIAAKRLGVPGPLLTYINELYSRSETVFEVGGESS 115 >SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) Length = 520 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + VG+PQGS L P +FIL + L ++ A Sbjct: 385 ITVGVPQGSILGPLMFILFINDLPLEVSNSA 415 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/46 (36%), Positives = 28/46 (60%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGK 329 +R+ E ++ Q M++VF+D KAFD V R++L+ + G P K Sbjct: 672 LRQLMEKTREQRNNMYIVFIDFVKAFDTVNRELLFSILGKLGCPPK 717 >SB_25600| Best HMM Match : RVT_1 (HMM E-Value=0.0074) Length = 337 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 F+ +VD KAFD V R L+ +K GV G++ +I++ + + + Sbjct: 12 FLFACYVDFSKAFDCVPRAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSI 60 >SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) Length = 583 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTN 260 + +VF+D++KAFD V + L K GVPG I + R+ T G+++ Sbjct: 104 LKLVFLDVKKAFDSVSHESLLIAAKRLGVPGPLLTYINELYSRSETVFEVGGESS 158 >SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.3 bits (70), Expect = 0.31 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = -3 Query: 317 YSSYAR*N-QYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLF 141 Y SY Q V + + +++ + G+P+GS LSP LF + +L +E P + Sbjct: 63 YKSYLNGRGQRVSVRGCQSEKLDLSCGVPKGSCLSPLLFTIYSSSLLQAFKEHLPSVHCY 122 Query: 140 ANEIVLVGEERPEA 99 A++ L P+A Sbjct: 123 ADDTQLYVSFSPKA 136 >SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) Length = 216 Score = 32.3 bits (70), Expect = 0.31 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -1 Query: 466 MREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTS 290 +R+ E + Q + F+DL KAFD V R L+ + + G P K I++ H G Sbjct: 38 LRQLQEKCREQQRPPFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRG 97 Query: 289 TYVCSAGDT 263 T C + + Sbjct: 98 TVKCESNSS 106 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 404 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 446 >SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 231 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 273 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 146 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 188 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 22 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 64 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L D Q Sbjct: 440 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLARDWQ 482 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 1 MYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 38 >SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 243 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 88 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 128 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 111 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 151 >SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) Length = 243 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 27 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 67 >SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 294 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 1 MYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 38 >SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) Length = 283 Score = 31.9 bits (69), Expect = 0.40 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 2/103 (1%) Frame = -3 Query: 332 EIPAAYSS--YAR*NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 ++ AY S Y +Y+R RWR + + LP G L+P +F ++ + + ++ Sbjct: 134 DLKDAYFSILYKPDRKYLRF-RWRNE-IYEFSCLPFGYSLAPRVFTKVLKPVVSHLRLNG 191 Query: 158 PWCMLFANEIVLVGEERPEA*MRLAK*KERLENVGMKISRTKT 30 ++F ++I+L+G E L+ + L ++G I+ K+ Sbjct: 192 CRVVIFLDDILLIGSSPQECFSHLSMLRLLLHDLGFIINEEKS 234 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 1952 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 1992 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 1745 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 1777 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEA 159 G+PQ S L P +FIL + L ++ A Sbjct: 801 GIPQSSILGPLMFILFINDLPLEVSNSA 828 >SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = -1 Query: 442 QNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDT 263 Q F+ +VD KAFD V R L+ +K G G++ +I++ + + + + Sbjct: 86 QKTNNFLFACYVDFSKAFDCVSRAKLFEKLKAVGFTGRFLDIIQSMYSNDKSSIKTESSI 145 Query: 262 NE 257 E Sbjct: 146 TE 147 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 1682 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 1722 >SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) Length = 333 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 1 MYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 38 >SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.9 bits (69), Expect = 0.40 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 418 MVFVDLEKAFDWVFRKVLW*NMK 350 MVFVD EKAFD + R++ W +K Sbjct: 1 MVFVDFEKAFDSIDREMFWKTLK 23 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 31.9 bits (69), Expect = 0.40 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATH-GRTSTYVCSAGDT 263 + + F+DL KAFD V R L+ + + G P K I++ H G T C + + Sbjct: 15 LFVAFIDLTKAFDSVSRDGLFHILPLVGCPPKLLNFIKSFHDGTRGTVKCESNSS 69 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 1 MYIVFVDFVKAFDTVNRELLFSILGKLGCPPKFISIIK 38 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 520 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 560 >SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) Length = 182 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +V+ G+PQG+ L P LF++ + + + IQ + LFA++ VL Sbjct: 36 TVLSGVPQGTVLGPILFLMFINDMPSGIQSQV---KLFADDSVL 76 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 31.5 bits (68), Expect = 0.53 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = -1 Query: 400 EKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAGDTNELVWW 245 EKAFD V RK LW M+ GV K ++R + + C+ D E+ W Sbjct: 404 EKAFDSVHRKSLWVIMEKYGVQEKIICIVRLFY---EDFQCAVEDQGEIGEW 452 >SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) Length = 414 Score = 31.5 bits (68), Expect = 0.53 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -1 Query: 442 QNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 Q F+ +VD KAFD V R L +K GV G++ +I++ + + V Sbjct: 86 QKTNNFLFACYVDFSKAFDCVPRAKLSEKLKAVGVTGRFLDIIQSMYSNDKSSV 139 >SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) Length = 189 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYV 281 F+ +VD KAFD V R L+ ++ GV G++ +I++ + + V Sbjct: 91 FLFACYVDFSKAFDCVPRAKLFEKLRAVGVTGRFLDIIQSMYSNDKSSV 139 >SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) Length = 654 Score = 31.5 bits (68), Expect = 0.53 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -3 Query: 278 LRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 L R QRV + G+PQGS L P LF + + +L I + P +A++ L Sbjct: 319 LSGRTQRV-YIEGVPQGSCLGPLLFNVYVSSLLEVIDKHLPMAHSYADDFQL 369 >SB_52511| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 513 Score = 31.5 bits (68), Expect = 0.53 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEE---APWCMLFAN 135 V+ G+PQG+ L P LF+L M T Q A C+L+ N Sbjct: 346 VISGVPQGTMLGPTLFLLFMTCRTLSPQTHKLFADDCVLYRN 387 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 31.5 bits (68), Expect = 0.53 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 V G+PQG+ L P LF+L M L +++ LFA++ +L G Sbjct: 478 VTSGVPQGTVLGPLLFLLYMNDLPDNLKSS---IRLFADDALLYG 519 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 31.5 bits (68), Expect = 0.53 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIR 311 M++VFVD KAFD V R++L+ + G P K+ +I+ Sbjct: 1 MYIVFVDFVKAFDTVNRELLFLILGKLGCPPKFISVIK 38 >SB_50555| Best HMM Match : Glutaredoxin (HMM E-Value=4.9) Length = 201 Score = 31.1 bits (67), Expect = 0.71 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEA 159 G+ QG L+PYLFILIM +Q+++ Sbjct: 61 GVKQGDPLAPYLFILIMEVFAVVVQDDS 88 >SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 290 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 260 RVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 R S+ G+PQGS L P+LF + L I+ P +A++ L Sbjct: 190 RCSLSFGVPQGSCLGPFLFSIYASKLFEVIKSHLPHAHAYADDTQL 235 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 254 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 300 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 321 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 358 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 80 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 126 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 147 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 184 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = -1 Query: 424 MHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRATHGRTSTYVCSAG 269 +++VFVD+ KAFD V + + +K GVP + + R++T + G Sbjct: 1281 LNLVFVDVRKAFDSVSHETILIALKRLGVPPPLLSYVCDLYSRSTTIIQHGG 1332 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 31.1 bits (67), Expect = 0.71 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -3 Query: 269 RYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 +Y V G+PQG+ L P LF+L + L +++ LFA++ +L G Sbjct: 50 QYTLKKVTSGVPQGTVLGPLLFLLYVNDLPDNLKSS---IRLFADDALLYG 97 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 498 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 544 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 565 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 602 >SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) Length = 251 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFDWVFRKVLW 362 + + R +E +++ + F FVDLEKAFD V R +LW Sbjct: 53 DAIFVVRQLQEKHLAKGKSLFF--AFVDLEKAFDRVPRVILW 92 >SB_50448| Best HMM Match : RVT_1 (HMM E-Value=3.7) Length = 390 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 G+PQGS L P LF+L L +Q P FA++ L Sbjct: 70 GVPQGSCLGPLLFVLYTSKLFEIVQAHLPDAHCFADDTQL 109 >SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 919 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 260 RVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 R S+ G+PQGS L P+LF + L I+ P +A++ L Sbjct: 790 RCSLSFGVPQGSCLGPFLFSIYASKLFEVIKSHLPHAHAYADDTQL 835 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 564 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 610 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 631 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 668 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 41 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 87 >SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) Length = 1275 Score = 31.1 bits (67), Expect = 0.71 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 302 VRSSNKPLVFPWHPSH---FHVSPQNLTENPIKRFFQINKHHVHE 427 +R ++K VF W P H F +TE P+ ++ +NK H+ Sbjct: 1173 LRLTDKDAVFDWLPQHQEAFEKIKMIITEAPVLHYYDVNKESGHK 1217 >SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 G+PQGS L P LF+L L +Q P FA++ L Sbjct: 625 GVPQGSCLGPLLFVLYTSKLFEIVQAHLPDAHCFADDTQL 664 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 1445 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 1491 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 80 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 126 >SB_5801| Best HMM Match : UvdE (HMM E-Value=2.2) Length = 255 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 G+PQGS L P LF+L L +Q P FA++ L Sbjct: 38 GVPQGSCLGPLLFVLYTSKLFEIVQAHLPDAHCFADDTQL 77 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 761 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 807 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 448 VSQNQFGFMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 ++ ++ F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 304 INMDRQKFNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 350 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 371 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 408 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 285 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 324 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 797 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 836 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -3 Query: 257 VSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +SV G+PQG+ L P +F+L + + D + LFA++ +L Sbjct: 663 ISVTSGVPQGTVLGPLMFLLYINDIGNDCKSST--IRLFADDTLL 705 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQ 168 +QYV++ R +S G+PQG+ L+P LF +++ L + Q Sbjct: 873 SQYVKIRDSRSHVISPKGGIPQGTRLAPLLFAILVNRLAREWQ 915 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 195 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 234 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 66 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 96 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 231 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 261 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 231 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 261 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 268 ITAGVPQGSILGPLMFILFINDLPLEVSNRA 298 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 524 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 563 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 19 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 49 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 17 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 56 >SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 152 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 182 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 45 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 75 >SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) Length = 657 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 G+PQGS L P LF+L L +Q P FA++ L Sbjct: 337 GVPQGSCLRPLLFVLYTSKLFEIVQAHLPDAHCFADDTQL 376 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 317 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 347 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 645 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 675 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + VG+P+GS L P +FIL + L ++ A Sbjct: 682 ITVGVPRGSILGPLMFILFINDLPLEVSNSA 712 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 103 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 142 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -1 Query: 427 FMHMVFVDLEKAFDWVFRKVLW*NMKVRGVPGKYQRLIRA 308 F +VF+DL+KAFD V +L +++ G+ G LI++ Sbjct: 6 FNLVVFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQS 45 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANE 132 + G+PQGS L P F+L + L + P LFA++ Sbjct: 66 ITCGIPQGSILGPLFFLLYINDLPECLLHTTP--RLFADD 103 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 194 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 233 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 17 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 56 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 231 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 261 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + G+PQGS L P +FIL + L ++ A Sbjct: 66 ITAGVPQGSILGPLMFILFINDLPLEVSNSA 96 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V+ G+PQG+ L P LF+L + L + I+ LFA++ VL Sbjct: 729 VLSGVPQGTVLGPILFLLFINDLPSGIKSHV---KLFADDSVL 768 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEA 159 + VG+P+GS L P +FIL + L ++ A Sbjct: 464 ITVGVPRGSILGPLMFILFINDLPLEVSNSA 494 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 346 SQYVIVNGSHSSKVHVTSGVPQGSVLGPTLFLL 378 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLV 120 SV G+PQGS L P LF+L L + C FA++ LV Sbjct: 183 SVTSGVPQGSLLGPILFLLYANDLPDVVHNSKVAC--FADDTKLV 225 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 74 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 106 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 184 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 216 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 400 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 444 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 368 SVVKHESERG-AREIPAAYSSYAR*NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 S + H RG A E ++Y S R Q+V + V + G+PQGS L P LFI+ Sbjct: 804 SKLAHYGIRGIANEWFSSYLSNRR--QFVSVNNSESDEVVLTHGVPQGSVLGPLLFII 859 >SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) Length = 193 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -3 Query: 293 QYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 Q V +L + SV G+PQGS L P LF L Sbjct: 74 QRVTVLGFTSSEASVTSGVPQGSLLGPILFCL 105 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = -3 Query: 293 QYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLV 120 Q V +L SV G+PQGS L P +F+L L + C FA++ LV Sbjct: 1680 QRVIVLGCTSSEASVTSGVPQGSLLGPIIFLLYANDLPDVVHNSKVAC--FADDTKLV 1735 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 207 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 239 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 773 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 805 >SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) Length = 208 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 62 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 106 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 +Q+V + + V V G+P G+FL P LF+L + + + + LFA++ ++ Sbjct: 819 SQFVAVDGAKSNAVPVTSGVPHGTFLGPTLFLLFINDIADSLDSQ---MRLFADDAIV 873 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 V G+PQG+ L P LF+L + + T ++ LFA++ VL Sbjct: 301 VTSGVPQGTVLGPVLFLLFINDMPTGLKSHV---RLFADDSVL 340 >SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) Length = 311 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 487 EKVIASRMREESEVSQNQFGFMHMVFVDLEKAFD 386 + + A+R +E V QNQ ++ FVDL KAFD Sbjct: 279 DMIFAARQIQEKSVEQNQD--LYTTFVDLTKAFD 310 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 293 QYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 QYV + R ++++ G+PQGS L P LF++ Sbjct: 1502 QYVDLGGARSSELTMLCGIPQGSTLGPLLFLI 1533 >SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIV 126 SV G+PQGS L P LF+L L + C+ ++V Sbjct: 22 SVTSGVPQGSLLGPILFLLYANDLPDVVHNSKVACLADGTKLV 64 >SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 171 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 62 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 106 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 180 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 212 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 532 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 576 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIM 192 ++ S+ G+PQGS L P LF++ M Sbjct: 139 EKSSITCGVPQGSILGPLLFLIYM 162 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 126 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 158 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 282 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 326 >SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 11 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 55 >SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) Length = 483 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 263 QRVSVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 + + V G+PQGS L P LF++ + +L D+ E L+A++ V+ Sbjct: 370 EELPVTHGVPQGSILGPLLFVIYINSL-PDVLESC-CASLYADDTVI 414 >SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 242 GLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVGEERP 105 G+PQGS L P LF L + ++ M++A++ L RP Sbjct: 476 GVPQGSVLGPLLFSLFFAPIEDVVRAHGLGAMIYADDTQLYVSIRP 521 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 296 NQYVRMLRWRYQRVSVVVGLPQGSFLSPYLFIL 198 +QYV + +V V G+PQGS L P LF+L Sbjct: 207 SQYVVVNGSHSSKVHVTSGVPQGSVLGPTLFLL 239 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SV G+PQG+ L P LF+L + L +I LFA++ +L Sbjct: 256 SVTSGVPQGTVLGPLLFLLFVNDLPLNISST---IRLFADDCLL 296 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SV G+PQG+ L P LF+L + L +I LFA++ +L Sbjct: 256 SVTSGVPQGTVLGPLLFLLFVNDLPLNISST---IRLFADDCLL 296 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 V G+PQG+ L P LF+L + L +++ LFA++ +L G Sbjct: 764 VTSGVPQGTVLGPLLFLLYVNDLPDNLKSS---IRLFADDALLYG 805 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 V G+PQG+ L P +F+L + + + I LFA++ +L G Sbjct: 228 VTSGVPQGTVLGPLMFLLFINDINSGITSR---IRLFADDTILYG 269 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SV G+PQG+ L P LF+L + L +I LFA++ +L Sbjct: 146 SVTSGVPQGTVLGPLLFLLFVNDLPLNISST---IRLFADDCLL 186 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 254 SVVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVL 123 SV G+PQG+ L P LF+L + L +I LFA++ +L Sbjct: 87 SVTSGVPQGTVLGPLLFLLFVNDLPLNISST---IRLFADDCLL 127 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 V G+PQG+ L P LF+L + L +++ LFA++ +L G Sbjct: 70 VTSGVPQGTVLGPLLFLLYVNDLPDNLKSS---IRLFADDALLYG 111 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -3 Query: 251 VVVGLPQGSFLSPYLFILIMYALTTDIQEEAPWCMLFANEIVLVG 117 V G+PQG+ L P +F+L + + + I LFA++ +L G Sbjct: 85 VTSGVPQGTVLGPLMFLLFINDINSGITSR---IRLFADDTILYG 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,765,703 Number of Sequences: 59808 Number of extensions: 443946 Number of successful extensions: 1987 Number of sequences better than 10.0: 453 Number of HSP's better than 10.0 without gapping: 1696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1986 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -