Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0693.Seq
         (618 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ441131-2|CAD29631.1|  208|Anopheles gambiae hypothetical prote...    27   0.64 
AJ439398-1|CAD28124.1|  208|Anopheles gambiae hypothetical prote...    27   0.64 
AJ439061-1|CAD27770.1|   89|Anopheles gambiae hypothetical prote...    27   0.64 
AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long fo...    25   2.0  

>AJ441131-2|CAD29631.1|  208|Anopheles gambiae hypothetical protein
           protein.
          Length = 208

 Score = 26.6 bits (56), Expect = 0.64
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 566 GCPTRPDGWQ 595
           GCPT PDGW+
Sbjct: 76  GCPTDPDGWR 85


>AJ439398-1|CAD28124.1|  208|Anopheles gambiae hypothetical protein
           protein.
          Length = 208

 Score = 26.6 bits (56), Expect = 0.64
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 566 GCPTRPDGWQ 595
           GCPT PDGW+
Sbjct: 76  GCPTDPDGWR 85


>AJ439061-1|CAD27770.1|   89|Anopheles gambiae hypothetical protein
           protein.
          Length = 89

 Score = 26.6 bits (56), Expect = 0.64
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 566 GCPTRPDGWQ 595
           GCPT PDGW+
Sbjct: 76  GCPTDPDGWR 85


>AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long form
           protein.
          Length = 311

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 508 TLIYFLYRPVLNSVVDEERQNVFFFMRDRDA 416
           T  Y  Y  +LNS V E+ +N F+F   R A
Sbjct: 255 THAYDYYSCLLNSSVKEDFRNAFYFHELRSA 285


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 626,332
Number of Sequences: 2352
Number of extensions: 11565
Number of successful extensions: 11
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)