BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0692.Seq (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 4.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 5.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 20 9.4 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = -2 Query: 106 WNRRWMLRFHHGYWNLYPSVLXPADVVDSS 17 W L HH +W+L ++VD + Sbjct: 197 WREDIGLNLHHWHWHLVYPFEGAREIVDKN 226 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 5.4 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -2 Query: 79 HHGYWNLYP 53 HHG WN P Sbjct: 72 HHGQWNYSP 80 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 164 HLKTVSGGGIEGNQD 208 H+KT +G G +G+ D Sbjct: 393 HVKTHNGNGKKGSSD 407 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.123 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,475 Number of Sequences: 336 Number of extensions: 988 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits)
- SilkBase 1999-2023 -