BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0692.Seq
(449 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4
>SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 623
Score = 27.5 bits (58), Expect = 5.4
Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
Frame = +2
Query: 53 RI*VPVAMMEA*HPPTVPAQVEELXPXQCXP-PKATPCHLKTVSG 184
R+ +PV + A HPP P Q E +C P P ++P L++ G
Sbjct: 520 RVLIPVVRLTAGHPP-CPVQAYE-RQLRCYPVPPSSPAFLQSSKG 562
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.313 0.123 0.387
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,014,486
Number of Sequences: 59808
Number of extensions: 112276
Number of successful extensions: 406
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 385
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 405
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 896151577
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
- SilkBase 1999-2023 -