BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0692.Seq (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28741-3|AAA68327.2| 410|Caenorhabditis elegans Hypothetical pr... 29 1.6 AL033514-14|CAA22101.2| 1420|Caenorhabditis elegans Hypothetical... 27 4.8 >U28741-3|AAA68327.2| 410|Caenorhabditis elegans Hypothetical protein F35D2.1 protein. Length = 410 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Frame = +2 Query: 95 PTVPAQV--EELXPXQCXPPKATPCHLKTVSG-----GGIEGNQDPVXKALPYS 235 PT+P ++ P C PP P H+ + G GG +G + + A+P S Sbjct: 176 PTLPMGQFGKQFMPMSCKPPLCNPYHMNLMMGVEHMWGGPDGAEGEIDVAIPMS 229 >AL033514-14|CAA22101.2| 1420|Caenorhabditis elegans Hypothetical protein Y75B8A.13 protein. Length = 1420 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 98 TVPAQVEELXPXQCXPPKATPCHLKTVSGGGIEGNQDPVXKA 223 T P Q EEL P+A+P +TV IE D +A Sbjct: 506 TAPPQEEELFDDALEDPEASPKSPETVDAAPIEEGSDAAPEA 547 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.313 0.123 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,693,557 Number of Sequences: 27780 Number of extensions: 86555 Number of successful extensions: 198 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 198 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -