BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0690.Seq (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.6 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 23 7.8 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 2.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 546 LHILLIVFDSSLISSKFFDHVLKFIMVSFVFITRFSLW 433 L +LL F SS +S+ D+ I +F I+RFS W Sbjct: 1026 LALLLSNFGSSSLSAPTADNETNKIAEAFNRISRFSNW 1063 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 290 LPSGPSIITSISRNLLL 240 L S PSI++SISR LL Sbjct: 142 LNSDPSIVSSISRGQLL 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,245 Number of Sequences: 2352 Number of extensions: 12924 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -