BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0687.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10890.1 68417.m01772 expressed protein 27 5.3 At3g49060.1 68416.m05360 protein kinase family protein / U-box d... 27 5.3 At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3) iden... 27 5.3 At2g36350.1 68415.m04461 protein kinase, putative similar to pro... 27 5.3 At5g38320.1 68418.m04625 expressed protein ; expression support... 27 7.0 At4g31630.1 68417.m04493 transcriptional factor B3 family protei... 27 9.3 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 106 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSN 5 ++T I +C RC+H S R K+R S R S++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNS 228 >At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 805 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 69 HLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIE 203 H+W + + R+ N SN MPP++ ++ K+ K+E Sbjct: 162 HIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLE 206 >At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3) identical to FUSCA3 GB:AAC35247 [Arabidopsis thaliana] (Plant J. 6, 379-387 (1994)) Length = 313 Score = 27.5 bits (58), Expect = 5.3 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = +3 Query: 105 RRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFARFEHSNLFK 284 RRS + + N+ PP+ PI+H L KI+PR + + +S + L K Sbjct: 53 RRSSS-SFNLLSFPPPMPPISHVPTPLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPK 111 Query: 285 VKLSAHL 305 AHL Sbjct: 112 KAAEAHL 118 >At2g36350.1 68415.m04461 protein kinase, putative similar to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 949 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 238 IQAAFLPALSTLICSK*NCRPTSTLTEEH 324 + + P+ S L+C K +C ST TE H Sbjct: 385 VDTSLEPSASQLLCQKCHCAVKSTSTENH 413 >At5g38320.1 68418.m04625 expressed protein ; expression supported by MPSS Length = 212 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 108 RSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSI-IPCTKYSSS 248 RSK + P +IPI + VL+ +I + Y + +P Y+S+ Sbjct: 85 RSKTDKYKTGLPRPEIIPIEDFEPVLEIEEIGDQEYEVKLPLLPYNST 132 >At4g31630.1 68417.m04493 transcriptional factor B3 family protein similar to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 512 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 282 KVKLSAHLDTHRRAPR*DFDIEPAFLERPVTDDMLRKRVSIT-RGCGAPTARAPNAN 449 KVK +A D H+ A R + A L TD+ + KR +T G + + RA N Sbjct: 402 KVKQAASSDGHKTADRKPRMTDQAPLAEEQTDNRVEKRAQVTEEGGPSRSTRADPGN 458 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,234,848 Number of Sequences: 28952 Number of extensions: 199538 Number of successful extensions: 420 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -