BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0686.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0799 + 7035380-7036148,7036587-7037080 29 2.1 07_01_0567 - 4214196-4214351,4214539-4214845,4215005-4215069,421... 28 6.5 >11_01_0799 + 7035380-7036148,7036587-7037080 Length = 420 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 337 DIHNQTNSPPNKFKIALMQKCPAQCSGSSFKAV 435 D+H++T+S P+ ++L+QK + G S + V Sbjct: 367 DVHSETDSTPSDCSVSLLQKMGVEMCGLSLEEV 399 >07_01_0567 - 4214196-4214351,4214539-4214845,4215005-4215069, 4215406-4215471,4215594-4215639,4215671-4216200 Length = 389 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -3 Query: 275 CFAHFQAQ---IDFCFSNSFHALNTHKNMYVLGESLFLSYLIIVLSFI 141 C +H Q + C NSF + T N Y + ++ + L+IVL++I Sbjct: 184 CVSHEQPMKICVQDCEVNSFLVVFTRINQYTISVNMIILALMIVLTYI 231 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,266,625 Number of Sequences: 37544 Number of extensions: 220028 Number of successful extensions: 349 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -