BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0685.Seq (604 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizos... 30 0.23 SPAC14C4.01c ||SPAC19D5.08c|DUF1770 family protein|Schizosacchar... 29 0.40 SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|S... 28 0.91 SPBC17F3.01c |rga5|SPBC557.01|GTPase activating protein Rga5|Sch... 26 4.9 SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po... 26 4.9 SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 26 4.9 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 4.9 SPBC30D10.08 |mgm101||mitochondrial nucleoid protein|Schizosacch... 25 6.4 SPBC16G5.15c |fkh2||fork head transcription factor Fkh2 |Schizos... 25 8.5 >SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 855 Score = 30.3 bits (65), Expect = 0.23 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 599 SKPGFVEETIXXTAKKR-TNITANPVALLPKTRDT 498 + PG + E + + KKR TN A P A LP T DT Sbjct: 557 TSPGVLPEGMAASLKKRTTNTAATPQAALPTTLDT 591 >SPAC14C4.01c ||SPAC19D5.08c|DUF1770 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 244 Score = 29.5 bits (63), Expect = 0.40 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -3 Query: 257 MPESSTRHNRYRLGR-RSSTKSL 192 +PE+ST HN+Y LG SST SL Sbjct: 84 IPENSTLHNKYELGAVESSTSSL 106 >SPBC1703.15c |vps33|SPBC2A9.01c|vacuolar sorting protein Vps33|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 28.3 bits (60), Expect = 0.91 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -3 Query: 209 SSTKSLRNWRFESYRCIGHAVTADGQSPSSDHDGRRARRGFHQRHSFLKR 60 SS++ + R ++ CIG ++ + SSD +GRR + +Q F+ + Sbjct: 274 SSSQITKEIRDINFNCIGPYLSKIARKLSSDFEGRRQAKTVNQIRDFVSK 323 >SPBC17F3.01c |rga5|SPBC557.01|GTPase activating protein Rga5|Schizosaccharomyces pombe|chr 2|||Manual Length = 361 Score = 25.8 bits (54), Expect = 4.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 492 LQSSDPLVSPLFYPNFFSHPDDMIVAKD 409 L ++D L + +F P SHPD + +KD Sbjct: 200 LMTADNLAA-IFQPGILSHPDHEVYSKD 226 >SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.8 bits (54), Expect = 4.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 351 CHILILGSCFQIFFSNI 401 CH +L +C I+FSN+ Sbjct: 35 CHYRVLPACLNIYFSNL 51 >SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.8 bits (54), Expect = 4.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 273 IRLHTDARIINSAQPLSAWSSILN 202 IR+H I+ QP+S W+ +L+ Sbjct: 754 IRIHVIGDILKLPQPISTWNKLLD 777 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 25.8 bits (54), Expect = 4.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +3 Query: 498 SIPCFWQER--HWIGCNIGPLLGSXXN-SLFH 584 ++PCFW+E+ W G +I L S + SLF+ Sbjct: 300 TVPCFWEEQFSSWYGPSISFLRSSQASQSLFN 331 >SPBC30D10.08 |mgm101||mitochondrial nucleoid protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 267 Score = 25.4 bits (53), Expect = 6.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 432 DDMIVAKDGLRYLKKISESKILESEYG 352 DD+ + DG+ YL +I +IL +G Sbjct: 124 DDIEIKPDGILYLPEIKYRRILNKAFG 150 >SPBC16G5.15c |fkh2||fork head transcription factor Fkh2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 25.0 bits (52), Expect = 8.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 560 AKKRTNITANPVALLPKTRDT 498 AKKR + P+ +LPK +DT Sbjct: 328 AKKREGSPSLPIPILPKMKDT 348 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,429,658 Number of Sequences: 5004 Number of extensions: 48407 Number of successful extensions: 156 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -