BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0685.Seq (604 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 66 2e-13 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 28 0.061 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.00 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 4.0 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 66.1 bits (154), Expect = 2e-13 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 6/65 (9%) Frame = -1 Query: 253 QNHQLGTTAIG------LVVDPQLKVYGIGGLRVIDASVMPSQPTGNPQAAIMMVAERGA 92 +NHQ GT +G VV P+LKV+GI GLRV DASV P +GNP A++ MV ER A Sbjct: 542 ENHQTGTAKMGPSYDPMAVVSPRLKVHGIRGLRVADASVQPQVISGNPVASVNMVGERAA 601 Query: 91 AFIKD 77 FIK+ Sbjct: 602 DFIKE 606 Score = 50.8 bits (116), Expect = 1e-08 Identities = 27/86 (31%), Positives = 46/86 (53%) Frame = -2 Query: 510 NKGYLTLQSSDPLVSPLFYPNFFSHPDDMIVAKDGLRYLKKISESKILESEYGIELDPEA 331 +KG +TL S DPL P+ + N + D V +R ++K+ + ++ + G+E Sbjct: 458 SKGRITLNSKDPLDPPVIWSNDLATEHDRSVMIQAIRVVQKLVNTTVMR-DLGVEFQKIE 516 Query: 330 TDECSETSEDWSDDWMECMIRLHTDA 253 +C E ED SDD+ C+I+ +T A Sbjct: 517 LKQCDEFVED-SDDYWNCVIQYNTRA 541 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 28.3 bits (60), Expect = 0.061 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 575 TIXXTAKKRTNITANPVALLPKTRDT*RCSLQTH*FLHYFIRISS 441 T AKK TNI PVA++ + + S Q H F H+ I++S+ Sbjct: 884 TTNTPAKKATNIGGKPVAVVKSSAQSLLQSNQQH-FPHHQIQVST 927 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.00 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -3 Query: 251 ESSTRHNRYRLGRRSSTKSLRNWR-FESYR 165 E T H RY R KS +N R + YR Sbjct: 264 EERTSHKRYSRSREREQKSYKNEREYRKYR 293 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +3 Query: 285 SSHLTSLLRSHYTHQSLRDLVL 350 + H T+L ++ H+SL++++L Sbjct: 94 AEHFTALGNFYFVHESLKNVLL 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,182 Number of Sequences: 438 Number of extensions: 3334 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -