BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0684.Seq (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.2 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 6.2 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 530 PALPNLIALQHIPLFAAGVIA 592 P P+ I H+P FAA V A Sbjct: 275 PQWPSPIGASHLPYFAAAVAA 295 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/40 (22%), Positives = 22/40 (55%) Frame = -1 Query: 183 SIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKDMLKML 64 ++K +E++ ++ + + D+I+V+P+ D K L Sbjct: 265 AVKRKEKKAQKEKDKPNSTTNGSPDVIKVEPELSDSEKTL 304 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,794 Number of Sequences: 336 Number of extensions: 2489 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -