BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0682.Seq
(615 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 24 4.5
>DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein.
Length = 418
Score = 23.8 bits (49), Expect = 4.5
Identities = 18/70 (25%), Positives = 28/70 (40%)
Frame = -3
Query: 277 LFSKTGTTPYANSIILPADLVLFRSMSKRRSVSSARPRIFLRLNQFRSLVSLRI*RNHCN 98
L S+ TTP S IL +L S ++ +F LNQ ++ R
Sbjct: 341 LISRGRTTPLKVSTILQKSCILVDEQGTEASAATEGTLVFTILNQPVKFIANRPFLFLIY 400
Query: 97 QCSVGHWVFS 68
G+W+F+
Sbjct: 401 DEGKGNWLFA 410
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 657,903
Number of Sequences: 2352
Number of extensions: 14225
Number of successful extensions: 118
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60132501
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -