BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0680.Seq (249 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF009227-1|AAC51756.1| 768|Homo sapiens gamma-heregulin protein. 28 6.3 >AF009227-1|AAC51756.1| 768|Homo sapiens gamma-heregulin protein. Length = 768 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 157 VTRWRRITYSDSSACLYRMAHLHGQLTPADHRRTST 50 V W R T S S+CL A+ + LT +H T T Sbjct: 129 VRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTET 164 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,209,130 Number of Sequences: 237096 Number of extensions: 586101 Number of successful extensions: 4586 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4586 length of database: 76,859,062 effective HSP length: 60 effective length of database: 62,633,302 effective search space used: 1377932644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -