BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0680.Seq (249 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 27 1.3 Z81487-3|CAB03997.2| 345|Caenorhabditis elegans Hypothetical pr... 25 9.4 U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel t... 25 9.4 DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-t... 25 9.4 AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-t... 25 9.4 AF067940-3|AAC19207.1| 272|Caenorhabditis elegans Hypothetical ... 25 9.4 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 148 WRRITYSDSSACLYRMAHLHG 86 WR I+YS SS C +R+ +G Sbjct: 438 WRNISYSGSSDCYWRIVSANG 458 >Z81487-3|CAB03997.2| 345|Caenorhabditis elegans Hypothetical protein C54E10.4 protein. Length = 345 Score = 24.6 bits (51), Expect = 9.4 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 143 EDHLFRFLRLPVPN 102 ++ +FR LRLPVPN Sbjct: 307 KEKVFRLLRLPVPN 320 >U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 2 protein. Length = 1785 Score = 24.6 bits (51), Expect = 9.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -3 Query: 166 AGSVTRWRRITYS 128 AG +T W+R+TY+ Sbjct: 1348 AGGITEWKRLTYT 1360 >DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1763 Score = 24.6 bits (51), Expect = 9.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -3 Query: 166 AGSVTRWRRITYS 128 AG +T W+R+TY+ Sbjct: 1326 AGGITEWKRLTYT 1338 >AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1785 Score = 24.6 bits (51), Expect = 9.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -3 Query: 166 AGSVTRWRRITYS 128 AG +T W+R+TY+ Sbjct: 1348 AGGITEWKRLTYT 1360 >AF067940-3|AAC19207.1| 272|Caenorhabditis elegans Hypothetical protein F36F12.8 protein. Length = 272 Score = 24.6 bits (51), Expect = 9.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 160 SVTRWRRITYSDSSACLYRMAHLHGQLTPADHRR 59 S+ R R++ +SD C+ L+ + T DH R Sbjct: 54 SLNRHRKLVHSDEYTCMLCARKLYLKETVRDHMR 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,049,038 Number of Sequences: 27780 Number of extensions: 80383 Number of successful extensions: 178 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 12,740,198 effective HSP length: 62 effective length of database: 11,017,838 effective search space used: 220356760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -