BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0678.Seq (590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 1.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 23 2.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 4.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.8 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = -3 Query: 318 LPDRRQKRLIFSTITTKMNLSVKWIWKSSWLDRTACPAPTSTPS 187 LP + ++L + + + N ++ + +W P+PTS+ S Sbjct: 80 LPALKSRKLNNNNVVSSTNQEIRGPKRKTWKVEEDSPSPTSSVS 123 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 243 WKSSWLDRTACPAPTSTPSVRRPACT 166 W ++ RT PT+T + RP T Sbjct: 1052 WTTTTTRRTTTTRPTTTSTTTRPTTT 1077 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 243 WKSSWLDRTACPA 205 W S WL+R A PA Sbjct: 86 WVSFWLNRNATPA 98 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 324 TQFSCRDGQVLATQ 365 T+F+CR G V TQ Sbjct: 500 TEFACRPGTVFHTQ 513 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 492 VKSFSRMASISSMKMIAGLSLWQDG 566 V S + +SS + LS W DG Sbjct: 1493 VPSAEKFIEVSSNSITLHLSAWSDG 1517 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,779 Number of Sequences: 336 Number of extensions: 2904 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -