BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0678.Seq (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33442| Best HMM Match : AAA (HMM E-Value=0) 154 6e-38 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 93 1e-19 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 71 5e-13 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 66 3e-11 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 66 3e-11 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 64 1e-10 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_732| Best HMM Match : AAA (HMM E-Value=0) 59 3e-09 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 58 4e-09 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 52 4e-07 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 46 3e-05 SB_58910| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_3478| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 40 0.001 SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_33137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) 28 5.0 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 28 5.0 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 28 5.0 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 28 5.0 SB_20665| Best HMM Match : 7tm_3 (HMM E-Value=1.8e-10) 28 5.0 SB_13828| Best HMM Match : HORMA (HMM E-Value=2.9) 28 5.0 SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 154 bits (373), Expect = 6e-38 Identities = 83/112 (74%), Positives = 86/112 (76%), Gaps = 1/112 (0%) Frame = -3 Query: 588 PRMVRXVFRLAKEIAQQSFSLMKLMPFY*K-I*RPNWCRREVQRILLELLNQMDGFDQTT 412 PRMVR VFRLAKE A + ++ K REVQRILLELLNQMDGFDQ Sbjct: 243 PRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNV 302 Query: 411 NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITTKMNLS 256 NVKVIMATNR DTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTIT KMNLS Sbjct: 303 NVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLS 354 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 96.3 bits (229), Expect = 2e-20 Identities = 56/111 (50%), Positives = 68/111 (61%), Gaps = 1/111 (0%) Frame = -3 Query: 585 RMVRXVFRLAKEIAQQSFSLMKLMPFY*K-I*RPNWCRREVQRILLELLNQMDGFDQTTN 409 ++VR F LAKE A + +L K REVQR +LELLNQ+DGF + Sbjct: 173 KLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSHHD 232 Query: 408 VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITTKMNLS 256 +KVI ATNR D LDPALLR GRLDRKIEFP PD+ + I + KMN+S Sbjct: 233 IKVIAATNRVDILDPALLRSGRLDRKIEFPNPDQEARARILQIHSRKMNVS 283 Score = 35.9 bits (79), Expect = 0.025 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = -2 Query: 256 GEVDLEEFVARPDRVSGADINAICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEYE 77 G+V+ +E D +GA + A+C EAGM A+R V +D+ G K ++ Sbjct: 284 GDVNFDELSRCTDDFNGAMLKAVCVEAGMIALRREATEVCHEDYMDGIMEVNAKKKANLV 343 Query: 76 FY 71 +Y Sbjct: 344 YY 345 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 93.5 bits (222), Expect = 1e-19 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 471 EVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD 310 EVQR +LEL+NQ+DGFD N+KV+MATNR DTLDPAL+RPGRLDRK+EF LPD Sbjct: 203 EVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPD 256 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 89.8 bits (213), Expect = 1e-18 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 471 EVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD 310 EVQR +LELLNQ+DGF+ T N+KVIMATNR D LD ALLRPGR+DRKIEFP P+ Sbjct: 310 EVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPN 363 Score = 31.9 bits (69), Expect = 0.40 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 190 ICQEAGMHAVRENRYIVLPKDFE 122 +C EAGM+A+RE R V +DFE Sbjct: 367 VCTEAGMYALRERRVHVTQEDFE 389 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 71.3 bits (167), Expect = 5e-13 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = -3 Query: 471 EVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL 292 E + L +LL +MDGF +TNV V+ TNR D LDPALLRPGR DR+I P PD + + Sbjct: 167 ERENTLNQLLVEMDGFSSSTNVVVLSGTNRPDVLDPALLRPGRFDRQIHLPAPDIKGRCS 226 Query: 291 IF 286 IF Sbjct: 227 IF 228 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 568 FPSCQRDSPAIIFIDEIDAI 509 F ++++P IIFIDEIDA+ Sbjct: 133 FAQARKNAPCIIFIDEIDAV 152 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/62 (53%), Positives = 39/62 (62%) Frame = -3 Query: 459 ILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFST 280 I+ LL MDG D V +I ATNR D +DPAL RPGR DR+ +F LPDR +R I S Sbjct: 1009 IVSTLLALMDGLDSRGEVVIIGATNRIDAIDPALRRPGRFDREFQFALPDRDARRSILSI 1068 Query: 279 IT 274 T Sbjct: 1069 HT 1070 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 65.7 bits (153), Expect = 3e-11 Identities = 28/69 (40%), Positives = 47/69 (68%) Frame = -3 Query: 462 RILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFS 283 R++ +LL Q+DG + V ++ AT+R D +DPALLRPGRLD+ + P+PD+ +R +F Sbjct: 786 RVVNQLLTQLDGVEGLKGVYILAATSRPDLIDPALLRPGRLDKCVYCPIPDQGDRREVFR 845 Query: 282 TITTKMNLS 256 ++ + L+ Sbjct: 846 ALSHDLPLA 854 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -3 Query: 462 RILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD 310 R++ ++L +MDG + NV +I ATNR D +DPA+LRPGRLD+ I PLPD Sbjct: 432 RVINQVLTEMDGMNVKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPD 482 Score = 53.6 bits (123), Expect = 1e-07 Identities = 28/69 (40%), Positives = 42/69 (60%) Frame = -3 Query: 465 QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIF 286 +RI+ +LL MDG Q ++V V+ ATNR +++D AL R GR DR+++ +PD + I Sbjct: 179 RRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDVALRRFGRFDREVDIGIPDATGRLEIL 238 Query: 285 STITTKMNL 259 T M L Sbjct: 239 RIHTKNMKL 247 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 256 GEVDLEEFVARPDRVSGADINAICQEAGMHAVRE 155 G+VDL+ SGAD+ ICQ A A+RE Sbjct: 484 GDVDLDYVAKVTHGFSGADLTEICQRACKLAIRE 517 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 60.9 bits (141), Expect = 8e-10 Identities = 33/73 (45%), Positives = 42/73 (57%) Frame = -3 Query: 471 EVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL 292 E RI+ +LL MDG + V VI ATNR + LDPAL RPGR DR++ +P Q+ Sbjct: 330 EENRIVAQLLTLMDGLESRGRVIVIGATNRPNALDPALRRPGRFDREVVIGVPSAGQRLD 389 Query: 291 IFSTITTKMNLSV 253 I +NLSV Sbjct: 390 ILRAHCKPINLSV 402 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Frame = -3 Query: 402 VIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLI------FSTITTKMNLSV 253 ++ ATNR + +D ALLRPGR+D I P PD + + I FS + ++LSV Sbjct: 701 LVAATNRPEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSV 756 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 58.8 bits (136), Expect = 3e-09 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = -3 Query: 459 ILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFST 280 ++ +LL ++DG +Q NV +I TNR D +D ALLRPGRL+ ++E LPD + I Sbjct: 280 VVNQLLAKIDGVEQLNNVLLIGMTNRRDLIDDALLRPGRLEVQVEIGLPDEEGRVQILKI 339 Query: 279 ITTKM 265 T KM Sbjct: 340 HTAKM 344 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 58.4 bits (135), Expect = 4e-09 Identities = 31/71 (43%), Positives = 41/71 (57%) Frame = -3 Query: 471 EVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL 292 E + L +LL +MDG + V ++ +TNRAD LD ALLRPGR DR I LP ++ Sbjct: 244 EQENTLNQLLVEMDGMNTLDGVIMLASTNRADILDNALLRPGRFDRHIAIDLPTLPERME 303 Query: 291 IFSTITTKMNL 259 IF K+ L Sbjct: 304 IFEVHLKKLTL 314 Score = 35.1 bits (77), Expect = 0.043 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -2 Query: 211 SGADINAICQEAGMHAVRENRYIVLPKDFE 122 SGADI IC EA +HA R N+ V K+FE Sbjct: 333 SGADIANICNEAALHAARLNKKNVDTKNFE 362 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 58.0 bits (134), Expect = 5e-09 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -3 Query: 468 VQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL- 292 + R++ +LL ++DG T +V VI ATNR D LDPALLRPGR D+ + + + +L Sbjct: 929 MDRVVAQLLAELDGLHSTCDVFVIGATNRPDLLDPALLRPGRFDKLLYLGVSEDHHAQLS 988 Query: 291 IFSTITTKMNLS 256 + +T K S Sbjct: 989 VLKALTRKFTFS 1000 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 57.2 bits (132), Expect = 9e-09 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = -3 Query: 465 QRILLELLNQMDGFDQT---TNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKR 295 +R++ LL MDG T V V+ ATNR D LDPAL RPGR DR+IE +P +R Sbjct: 374 RRVVATLLTLMDGMHMKSTDTYVMVLAATNRPDALDPALRRPGRFDREIEIGIPSVTDRR 433 Query: 294 LIFSTI 277 I T+ Sbjct: 434 DILVTL 439 Score = 57.2 bits (132), Expect = 9e-09 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 462 RILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP 313 R+L +LL ++DG + +V I ATNR D +D AL+RPGR+DR I PLP Sbjct: 657 RVLTQLLTELDGVETLKDVIFIAATNRPDMIDKALMRPGRVDRLIYVPLP 706 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = -2 Query: 292 NLLDNHYQDEPF-GEVDLEEFVARPDRVSGADINAICQEAGMHAVREN 152 ++L+ H P G +DLE+ V R + SGA+I A+C+EA + A++EN Sbjct: 713 HILEIHLARTPCEGSLDLEDLVERTEGYSGAEIAAVCREAALAALQEN 760 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 568 FPSCQRDSPAIIFIDEIDAI 509 F Q SP+I+FIDE+DA+ Sbjct: 342 FTEAQNKSPSIVFIDELDAL 361 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = -3 Query: 492 RPNWCRREVQRILLELLNQMDGFDQT--TNVKVIMATNRADTLDPALLRPGRLDRKIEFP 319 R N + +RI+ +LL+ MD + +V VI ATNR D+LDPAL R GR DR+I Sbjct: 785 RENASKDMERRIVSQLLSCMDDLNNNPDAHVLVIGATNRPDSLDPALRRAGRFDREISMG 844 Query: 318 LPDRRQKRLI 289 +PD + I Sbjct: 845 IPDESARARI 854 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 568 FPSCQRDSPAIIFIDEIDAILLK 500 F S +P I+F+DEIDAI K Sbjct: 762 FTSAVAQAPCILFLDEIDAITPK 784 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 45.6 bits (103), Expect = 3e-05 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = -3 Query: 447 LLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFS 283 LLN +DG + V M TN LDPAL+RPGR+D K E R Q +F+ Sbjct: 312 LLNTLDGVASSEERVVFMTTNHLKRLDPALIRPGRVDFKQEIDWASRSQLVRMFA 366 >SB_58910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = -2 Query: 247 DLEEFVARPDRVSGADINAICQEAGMHAVRENRYIVLPKDFEKGYK--NNIKKDESEYEF 74 D E V D +GAD+ +C EAGM A+R R V+ +DF K + ++ KK ES+ ++ Sbjct: 115 DYEAVVKLSDGFNGADLRNVCTEAGMFAIRGERDYVIEEDFMKAVRKVSDNKKLESKLDY 174 >SB_3478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -3 Query: 345 RLDRKIEFPLPDRRQKRLIFSTITTKMNLS 256 R+DRKIEFP+PD + KR IF+ T +M L+ Sbjct: 2 RIDRKIEFPMPDEKTKRRIFNIHTQRMTLA 31 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Frame = -3 Query: 402 VIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLI------FSTITTKMNLSV 253 ++ ATNR + +D ALLRPGR+D I P PD + + I FS + ++LSV Sbjct: 234 LVAATNRPEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSV 289 >SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -3 Query: 462 RILLELLNQMDGFDQTTN-VKVIMATNRADTLDPALLRPGRLDRKIEFPLP 313 R+ ELL QMDG ++ + V ++ A+N LD A+LR RL+++I LP Sbjct: 126 RMKTELLVQMDGLARSDDLVFLLAASNLPWELDHAMLR--RLEKRILVDLP 174 >SB_33137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 128 IFRKYNVSVFPDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTER 262 I K S PDS+ + + G DVG G +R+ EL + ++R Sbjct: 147 IIPKGGPSTLPDSMFKIIDSTGPDVGGGPVMRNGLELLALAISDR 191 >SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) Length = 1031 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 155 FPDSVHAGLLTDGVDVGAG---HAVRSSHELFQIHFTE 259 F D + LLT G+D G AVRS H+L IH E Sbjct: 884 FMDLPQSPLLTMGMDTPLGWMVEAVRSPHDLDNIHLAE 921 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 158 PDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTERFILVVIVEKIKRF*RLSGRGNSIFL 337 PDS+ +L + + V A H V +HF +F+L V+ RL G F Sbjct: 110 PDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRLDKEGKLHFE 169 Query: 338 SRR 346 +++ Sbjct: 170 AKK 172 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 158 PDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTERFILVVIVEKIKRF*RLSGRGNSIFL 337 PDS+ +L + + V A H V +HF +F+L V+ RL G F Sbjct: 344 PDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRLDKEGKLHFE 403 Query: 338 SRR 346 +++ Sbjct: 404 AKK 406 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 158 PDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTERFILVVIVEKIKRF*RLSGRGNSIFL 337 PDS+ +L + + V A H V +HF +F+L V+ RL G F Sbjct: 110 PDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRLDKEGKLHFE 169 Query: 338 SRR 346 +++ Sbjct: 170 AKK 172 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 158 PDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTERFILVVIVEKIKRF*RLSGRGNSIFL 337 PDS+ +L + + V A H V +HF +F+L V+ RL G F Sbjct: 110 PDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRLDKEGKLHFE 169 Query: 338 SRR 346 +++ Sbjct: 170 AKK 172 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 158 PDSVHAGLLTDGVDVGAGHAVRSSHELFQIHFTERFILVVIVEKIKRF*RLSGRGNSIFL 337 PDS+ +L + + V A H V +HF +F+L V+ RL G F Sbjct: 110 PDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRLDKEGKLHFE 169 Query: 338 SRR 346 +++ Sbjct: 170 AKK 172 >SB_20665| Best HMM Match : 7tm_3 (HMM E-Value=1.8e-10) Length = 1514 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 246 IWKSSWLDRTACPAP-TSTPSVRRPACT 166 +WK W ACP P T+ VR PA T Sbjct: 14 LWKHGWPSVLACPRPLTAVAQVRIPAQT 41 >SB_13828| Best HMM Match : HORMA (HMM E-Value=2.9) Length = 225 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = -3 Query: 480 CRREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQ 301 C++ +QR +L LL F Q +M+T T +P PG +E P P+ Q Sbjct: 113 CKKVIQRCVLLLLGVKSSFPQDAEFLALMSTANKATCEPQ-AAPG---DPVEVPRPEPLQ 168 >SB_49281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 227 STGPRVRRRHQRHLSG 180 ST P+ +RRH RH SG Sbjct: 566 STSPKAKRRHHRHSSG 581 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,698,059 Number of Sequences: 59808 Number of extensions: 358328 Number of successful extensions: 888 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -