BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0676.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61010.2 68414.m06870 cleavage and polyadenylation specificit... 28 5.4 At1g61010.1 68414.m06869 cleavage and polyadenylation specificit... 28 5.4 >At1g61010.2 68414.m06870 cleavage and polyadenylation specificity factor, putative similar to cleavage and polyadenylation specificity factor 73 kDa subunit [Homo sapiens] SWISS-PROT:Q9UKF6 Length = 693 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 516 PNIENGS*DLSNQIRLKMKILPPNPKSSQKLMAPXNMKRNQVRIXNKK 373 PNI + + +RLK K+L P + K+M P N + ++ ++K Sbjct: 422 PNIILVHGEANEMMRLKQKLLTEFPDGNTKIMTPKNCESVEMYFNSEK 469 >At1g61010.1 68414.m06869 cleavage and polyadenylation specificity factor, putative similar to cleavage and polyadenylation specificity factor 73 kDa subunit [Homo sapiens] SWISS-PROT:Q9UKF6 Length = 693 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 516 PNIENGS*DLSNQIRLKMKILPPNPKSSQKLMAPXNMKRNQVRIXNKK 373 PNI + + +RLK K+L P + K+M P N + ++ ++K Sbjct: 422 PNIILVHGEANEMMRLKQKLLTEFPDGNTKIMTPKNCESVEMYFNSEK 469 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,571,890 Number of Sequences: 28952 Number of extensions: 153784 Number of successful extensions: 290 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -