BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0674.Seq (605 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132898-8|CAB60959.1| 297|Caenorhabditis elegans Hypothetical ... 28 5.9 Z72510-3|CAA96653.1| 366|Caenorhabditis elegans Hypothetical pr... 27 7.9 >AL132898-8|CAB60959.1| 297|Caenorhabditis elegans Hypothetical protein Y59A8B.11 protein. Length = 297 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -2 Query: 418 DIEYLGVRSVRAWRILLLKPLIAQSSTIPILLSFVFSTVRVFGSNF 281 D YL V R +LLK + +S I F VRVF NF Sbjct: 221 DTAYLSVADAVKIRDILLKSTVFESGIITSRNIFSVGVVRVFNPNF 266 >Z72510-3|CAA96653.1| 366|Caenorhabditis elegans Hypothetical protein F53B7.4 protein. Length = 366 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 138 RECKALLYNNIRCSSSNVLYDCDCYC 61 +EC + Y +IRC ++ Y+C YC Sbjct: 128 KECSS--YESIRCPEYSLCYNCSKYC 151 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,669,455 Number of Sequences: 27780 Number of extensions: 243152 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1300523034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -