BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0672.Seq (538 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1640 + 38836977-38836988,38837694-38838047,38838164-388382... 30 1.3 07_03_0493 + 18747427-18748356,18748594-18748697,18749586-187497... 27 9.5 >01_06_1640 + 38836977-38836988,38837694-38838047,38838164-38838294, 38838554-38838860,38839036-38839349,38839507-38839645 Length = 418 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 159 WLSIIIHQRMFEQLLYCHLIICRHY 233 W + +H RM L CH+ +CRH+ Sbjct: 351 WQLLELHSRMCSALETCHVPLCRHF 375 >07_03_0493 + 18747427-18748356,18748594-18748697,18749586-18749795, 18749992-18750597,18750819-18751095,18751163-18751310, 18751957-18752044,18752167-18752284 Length = 826 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 162 LSIIIHQRMFEQLLYCHLIICRHYYF*SVCVINGGCINSVMFL*T 296 L II+ + + +C L +C H YF S+ V N VM T Sbjct: 329 LLIIVMCKSHYHVSFCRLYLCEHKYFLSLFVPYVASANIVMLFDT 373 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,065,571 Number of Sequences: 37544 Number of extensions: 193964 Number of successful extensions: 221 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -