BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0672.Seq (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27994| Best HMM Match : IF-2B (HMM E-Value=5.5e-23) 31 0.79 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 28 5.6 >SB_27994| Best HMM Match : IF-2B (HMM E-Value=5.5e-23) Length = 296 Score = 30.7 bits (66), Expect = 0.79 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 281 NTIDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 + I T A++H H++E+IM+ T+E K++ Sbjct: 135 DNIATQALEHIHSNEVIMTAGKSRTVETFLKNA 167 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 318 LQEIKGNAYRXFVLQLQILKYDFNV 392 LQ +KGN+ FV+ L +KY F + Sbjct: 2449 LQTLKGNSSLDFVMDLDAIKYSFRL 2473 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,467,561 Number of Sequences: 59808 Number of extensions: 246094 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -