BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0671.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 1.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 1.2 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 23 1.5 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 21 4.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 4.7 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 6.2 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 194 IEAIFSVKLPENWNGQRTESIRRYCTC 114 + A+ + K+PEN+N + Y TC Sbjct: 690 VYAVKTRKIPENFNESKFIGFTMYTTC 716 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 194 IEAIFSVKLPENWNGQRTESIRRYCTC 114 + A+ + K+PEN+N + Y TC Sbjct: 780 VYAVKTRKIPENFNESKFIGFTMYTTC 806 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 23.0 bits (47), Expect = 1.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 101 GVAMGMYNTDESIRSFAH 154 G+ G Y+ DE +++F H Sbjct: 94 GIIEGQYHDDEDLKTFFH 111 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.4 bits (43), Expect = 4.7 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +3 Query: 120 TIPTNRFGPLPIPVFR*LYRKNGLYTCLXKNTILKRYDGR 239 T P + P+P R NG + +LK DGR Sbjct: 25 TTPRRKKNKKPLPTECVFCRNNGEEEAYYRKHLLKDADGR 64 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 194 IEAIFSVKLPENWNGQRTESIRRYCTC 114 + A+ + K+PE +N + Y TC Sbjct: 832 VYAVLTRKIPEAFNESKHIGFTMYTTC 858 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 163 KTGMGKGP 140 KTG+GKGP Sbjct: 562 KTGLGKGP 569 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,542 Number of Sequences: 438 Number of extensions: 2664 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -