BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0670.Seq (429 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK098423-1|BAC05305.1| 485|Homo sapiens protein ( Homo sapiens ... 30 2.9 BC030023-1|AAH30023.1| 440|Homo sapiens glycosyltransferase 8 d... 29 8.8 >AK098423-1|BAC05305.1| 485|Homo sapiens protein ( Homo sapiens cDNA FLJ25557 fis, clone JTH02756. ). Length = 485 Score = 30.3 bits (65), Expect = 2.9 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 87 AVAALMKTVPRVVMKMYRPPTVPVTLIQTQTXQDPEHPAAAALMDTVPTVV 239 +V +++T+P ++M+ P V VT+IQT A A VP+ V Sbjct: 384 SVMLILRTMPTLMMRTEDRPKVAVTMIQTAAAMGVASGAGATAAAPVPSPV 434 >BC030023-1|AAH30023.1| 440|Homo sapiens glycosyltransferase 8 domain containing 3 protein. Length = 440 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 179 CLSLNQCYWNCRWSIHFHHDSWNCLHESCYR 87 C + CYWN W + NC E+ +R Sbjct: 75 CKDFSLCYWNPYWMLPSDVCGMNCFWEAAFR 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,224,531 Number of Sequences: 237096 Number of extensions: 788822 Number of successful extensions: 2285 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2285 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -